Running PSORTb v3.0 on Pf6N2E2_3953 FitnessBrowser__pseudo6_N2E2:Pf6N2E2_3953 (260 amino acids)
SeqID: Pf6N2E2_3953 FitnessBrowser__pseudo6_N2E2:Pf6N2E2_3953 Analysis Report: CMSVM- Unknown [No details] CytoSVM- Unknown [No details] ECSVM- Unknown [No details] ModHMM- Unknown [No internal helices found] Motif- Unknown [No motifs found] OMPMotif- Unknown [No motifs found] OMSVM- Unknown [No details] PPSVM- Periplasmic [No details] Profile- Unknown [No matches to profiles found] SCL-BLAST- CytoplasmicMembrane [matched 128372: Lipoprotein 28 precursor] SCL-BLASTe- Unknown [No matches against database] Signal- Non-Cytoplasmic [Signal peptide detected] Localization Scores: Periplasmic 4.96 CytoplasmicMembrane 4.96 Extracellular 0.07 OuterMembrane 0.01 Cytoplasmic 0.00 Final Prediction: Unknown (This protein may have multiple localization sites.) -------------------------------------------------------------------------------
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in the ENIGMA genome browser
>Pf6N2E2_3953 FitnessBrowser__pseudo6_N2E2:Pf6N2E2_3953 MKKVLLFTALAAALASGLAQAAEKLVVAATPVPHAEILELIKPALAKEGVDLEIKVFTDY VQPNVQVDQKRLDANYFQTLPYLTNFNEGKGTHLVTVIGVHVEPFGGYSKKYKKLADLPN GATIALPNEGSNSGRALILLQKAGLIELKDPKNALATPKDIAKNPHNFKFKELESAMLPR VLDQVDLDLINTNYALEAGLNPAKDALVIEGADSPYVNFLVARPDNKDSPAIQKLAKALT SPEVKAFIEKKYSGAVLPAF
Lawrence Berkeley National Laboratory