PSORTb v3.0 (Gram-negative)

Running PSORTb v3.0 on Pf6N2E2_3953 FitnessBrowser__pseudo6_N2E2:Pf6N2E2_3953 (260 amino acids)

SeqID: Pf6N2E2_3953 FitnessBrowser__pseudo6_N2E2:Pf6N2E2_3953
  Analysis Report:
    CMSVM-            Unknown                       [No details]
    CytoSVM-          Unknown                       [No details]
    ECSVM-            Unknown                       [No details]
    ModHMM-           Unknown                       [No internal helices found]
    Motif-            Unknown                       [No motifs found]
    OMPMotif-         Unknown                       [No motifs found]
    OMSVM-            Unknown                       [No details]
    PPSVM-            Periplasmic                   [No details]
    Profile-          Unknown                       [No matches to profiles found]
    SCL-BLAST-        CytoplasmicMembrane           [matched 128372: Lipoprotein 28 precursor]
    SCL-BLASTe-       Unknown                       [No matches against database]
    Signal-           Non-Cytoplasmic               [Signal peptide detected]
  Localization Scores:
    Periplasmic            4.96
    CytoplasmicMembrane    4.96
    Extracellular          0.07
    OuterMembrane          0.01
    Cytoplasmic            0.00
  Final Prediction:
    Unknown (This protein may have multiple localization sites.)

-------------------------------------------------------------------------------

Other sequence analysis tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in the ENIGMA genome browser

Input

>Pf6N2E2_3953 FitnessBrowser__pseudo6_N2E2:Pf6N2E2_3953
MKKVLLFTALAAALASGLAQAAEKLVVAATPVPHAEILELIKPALAKEGVDLEIKVFTDY
VQPNVQVDQKRLDANYFQTLPYLTNFNEGKGTHLVTVIGVHVEPFGGYSKKYKKLADLPN
GATIALPNEGSNSGRALILLQKAGLIELKDPKNALATPKDIAKNPHNFKFKELESAMLPR
VLDQVDLDLINTNYALEAGLNPAKDALVIEGADSPYVNFLVARPDNKDSPAIQKLAKALT
SPEVKAFIEKKYSGAVLPAF

by Morgan Price, Arkin group
Lawrence Berkeley National Laboratory