PSORTb v3.0 (Gram-negative)

Running PSORTb v3.0 on PfGW456L13_1569 Putrescine transport ATP-binding protein PotA (TC 3.A.1.11.1) (372 amino acids)

SeqID: PfGW456L13_1569 Putrescine transport ATP-binding protein PotA (TC 3.A.1.11.1)
  Analysis Report:
    CMSVM-            CytoplasmicMembrane           [No details]
    CytoSVM-          Cytoplasmic                   [No details]
    ECSVM-            Unknown                       [No details]
    ModHMM-           Unknown                       [No internal helices found]
    Motif-            Unknown                       [No motifs found]
    OMPMotif-         Unknown                       [No motifs found]
    OMSVM-            Unknown                       [No details]
    PPSVM-            Unknown                       [No details]
    Profile-          Unknown                       [No matches to profiles found]
    SCL-BLAST-        CytoplasmicMembrane           [matched 20141512: Maltose/maltodextrin import ATP-binding protein malK]
    SCL-BLASTe-       Unknown                       [No matches against database]
    Signal-           Unknown                       [No signal peptide detected]
  Localization Scores:
    CytoplasmicMembrane    9.99
    Cytoplasmic            0.01
    Periplasmic            0.00
    Extracellular          0.00
    OuterMembrane          0.00
  Final Prediction:
    CytoplasmicMembrane    9.99

-------------------------------------------------------------------------------

Other sequence analysis tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in the ENIGMA genome browser

Input

>PfGW456L13_1569 Putrescine transport ATP-binding protein PotA (TC 3.A.1.11.1)
MNALHSLQTLAVSIRSVRKVYGDPKTGPVALKSIDLDIRDNEFFTLLGPSGCGKTTLLRM
IAGFEFPTEGEILLYGENIADRPPFQRPVNTVFQHYALFPHMTIAENLAFGLESHPMGKV
LHKTQLAERVREMLALVQMERFANRKPAQLSGGQQQRVALARALAPHPKVLLLDEPLSAL
DLKLRQAMREELKTIQARTGITFIFVTHDQEEALTMSDRIAVLSEGEVQQVGRPEDIYER
PRNRFVADFIGETNFIEGTVTRVEDGLAWFAGPAGHPLPAQPCSDVRVGANVTLSVRPER
LHLVPATTENALPCRIEAQIYLGTDLQYQVSLSDGSRLTVRTPNCVDQSKRFAVGSQAGL
LFDQGSASVLHD

by Morgan Price, Arkin group
Lawrence Berkeley National Laboratory