PSORTb v3.0 (Gram-negative)

Running PSORTb v3.0 on PfGW456L13_1739 FitnessBrowser__pseudo13_GW456_L13:PfGW456L13_1739 (307 amino acids)

SeqID: PfGW456L13_1739 FitnessBrowser__pseudo13_GW456_L13:PfGW456L13_1739
  Analysis Report:
    CMSVM-            Unknown                       [No details]
    CytoSVM-          Cytoplasmic                   [No details]
    ECSVM-            Unknown                       [No details]
    ModHMM-           Unknown                       [No internal helices found]
    Motif-            Unknown                       [No motifs found]
    OMPMotif-         Unknown                       [No motifs found]
    OMSVM-            Unknown                       [No details]
    PPSVM-            Unknown                       [No details]
    Profile-          Unknown                       [No matches to profiles found]
    SCL-BLAST-        Cytoplasmic                   [matched 12230948: Ornithine carbamoyltransferase]
    SCL-BLASTe-       Unknown                       [No matches against database]
    Signal-           Unknown                       [No signal peptide detected]
  Localization Scores:
    Cytoplasmic            9.97
    Periplasmic            0.01
    CytoplasmicMembrane    0.01
    Extracellular          0.00
    OuterMembrane          0.00
  Final Prediction:
    Cytoplasmic            9.97

-------------------------------------------------------------------------------

Other sequence analysis tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in the ENIGMA genome browser

Input

>PfGW456L13_1739 FitnessBrowser__pseudo13_GW456_L13:PfGW456L13_1739
MMSARHFLSLMDCTPEELVSVIRRGVELKDLRNRGVLFEPLKNRVLGMIFEKSSTRTRIS
FEAGMIQLGGQAIFLSPRDTQLGRGEPIGDCAIVMSSMLDAVMIRTFAHSNLTEFAANSR
VPVINGLSDDLHPCQLLADMQTFLEHRGSIQGKTVAWIGDGNNMCNSYIEAAIQFDFQLR
VACPEGYEPNPVFLAKAGDRVTIVRDPKEAVRGAHLVSTDVWTSMGQEEETAKRLQLFAP
YQVNRALLDLAAEDVLFMHCLPAHRGEEISIDLLDDKRSVAWDQAENRLHAQKALLEFLV
EPAYHHA

by Morgan Price, Arkin group
Lawrence Berkeley National Laboratory