PSORTb v3.0 (Gram-negative)

Running PSORTb v3.0 on PfGW456L13_2701 FitnessBrowser__pseudo13_GW456_L13:PfGW456L13_2701 (129 amino acids)

SeqID: PfGW456L13_2701 FitnessBrowser__pseudo13_GW456_L13:PfGW456L13_2701
  Analysis Report:
    CMSVM-            Unknown                       [No details]
    CytoSVM-          Unknown                       [No details]
    ECSVM-            Unknown                       [No details]
    ModHMM-           Unknown                       [1 internal helix found]
    Motif-            Unknown                       [No motifs found]
    OMPMotif-         Unknown                       [No motifs found]
    OMSVM-            Unknown                       [No details]
    PPSVM-            Unknown                       [No details]
    Profile-          Unknown                       [No matches to profiles found]
    SCL-BLAST-        Periplasmic                   [matched 2493977: Periplasmic protein]
    SCL-BLASTe-       Unknown                       [No matches against database]
    Signal-           Non-Cytoplasmic               [Signal peptide detected]
  Localization Scores:
    Periplasmic            9.76
    Extracellular          0.11
    CytoplasmicMembrane    0.06
    OuterMembrane          0.06
    Cytoplasmic            0.00
  Final Prediction:
    Periplasmic            9.76

-------------------------------------------------------------------------------

Other sequence analysis tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in the ENIGMA genome browser

Input

>PfGW456L13_2701 FitnessBrowser__pseudo13_GW456_L13:PfGW456L13_2701
MKKLAALTLASALTAGLFSTPTLAAGDVQAGEKVYKRLCSGCHQIGESARAFFGPQLNGV
IGRHSAVTTDYVYSDAMKSANLVWDRETLIAYLEAPKKVVPGTRMIFWGLSDPEKIEDLL
AYLQTFPAQ