PSORTb v3.0 (Gram-negative)

Running PSORTb v3.0 on PfGW456L13_445 Cystine ABC transporter, permease protein (221 amino acids)

SeqID: PfGW456L13_445 Cystine ABC transporter, permease protein
  Analysis Report:
    CMSVM-            CytoplasmicMembrane           [No details]
    CytoSVM-          Unknown                       [No details]
    ECSVM-            Unknown                       [No details]
    ModHMM-           CytoplasmicMembrane           [3 internal helices found]
    Motif-            Unknown                       [No motifs found]
    OMPMotif-         Unknown                       [No motifs found]
    OMSVM-            Unknown                       [No details]
    PPSVM-            Unknown                       [No details]
    Profile-          Unknown                       [No matches to profiles found]
    SCL-BLAST-        CytoplasmicMembrane           [matched 84027924: Inner membrane amino-acid ABC transporter permease protein yecS]
    SCL-BLASTe-       Unknown                       [No matches against database]
    Signal-           Unknown                       [No signal peptide detected]
  Localization Scores:
    CytoplasmicMembrane    10.00
    Cytoplasmic            0.00
    Periplasmic            0.00
    Extracellular          0.00
    OuterMembrane          0.00
  Final Prediction:
    CytoplasmicMembrane    10.00

-------------------------------------------------------------------------------

Other sequence analysis tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in the ENIGMA genome browser

Input

>PfGW456L13_445 Cystine ABC transporter, permease protein
MEEAFQLALDSAPFLLKGAYYTVILSLGGMFFGLVMGFGLALMRLSRFKLVSWIARIYVS
FFRGTPLLVQLFVIYYGLPQLGLELDPLPAALIGFSLNMAAYACEILRAAISSIERGQWE
AAASIGMTRAQTLRRAILPQAMRTALPPLGNSFISLVKDTALAATIQVPELFRQAQLITA
RTFEIFTMYLAAALIYWVLATVLSHLQNQLEARVNRHDQES