PSORTb v3.0 (Gram-negative)

Running PSORTb v3.0 on PfGW456L13_4526 FitnessBrowser__pseudo13_GW456_L13:PfGW456L13_4526 (325 amino acids)

SeqID: PfGW456L13_4526 FitnessBrowser__pseudo13_GW456_L13:PfGW456L13_4526
  Analysis Report:
    CMSVM-            Unknown                       [No details]
    CytoSVM-          Unknown                       [No details]
    ECSVM-            Unknown                       [No details]
    ModHMM-           Unknown                       [No internal helices found]
    Motif-            Unknown                       [No motifs found]
    OMPMotif-         Unknown                       [No motifs found]
    OMSVM-            Unknown                       [No details]
    PPSVM-            Periplasmic                   [No details]
    Profile-          Unknown                       [No matches to profiles found]
    SCL-BLAST-        Periplasmic                   [matched 11128402: Periplasmic protein]
    SCL-BLASTe-       Unknown                       [No matches against database]
    Signal-           Non-Cytoplasmic               [Signal peptide detected]
  Localization Scores:
    Periplasmic            10.00
    Extracellular          0.00
    CytoplasmicMembrane    0.00
    OuterMembrane          0.00
    Cytoplasmic            0.00
  Final Prediction:
    Periplasmic            10.00

-------------------------------------------------------------------------------

Other sequence analysis tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in the ENIGMA genome browser

Input

>PfGW456L13_4526 FitnessBrowser__pseudo13_GW456_L13:PfGW456L13_4526
MNLSMRKIALAASVLLFTGHALAEPKRPECIAPASPGGGFDLTCKLAQSALVNEKLLTKP
MRVTYMPGGVGAVAYNAVVAQRPADAGTLVAWSSGSLLNLAQGKFGRFDESHVRWLAAVG
TSYGAIAVKSDSPYKTLDDLVQALKKDPSKVVIGSGGTVGSQDWMQTALIAKAAGINPRD
LRYVALEGGGEIATALLGGHIQVGSTDISDSMPHIQSGDMRLLAVFSDKRLDEPEMKDIP
TAREQGYDIVWPVVRGFYLGPKVSDEDYAWWKDSFDKLLASPEFAKLRDQRELFPFAMTG
PELDTYVKKQVADYKVLAKEFGLIQ

by Morgan Price, Arkin group
Lawrence Berkeley National Laboratory