PSORTb v3.0 (Gram-negative)

Running PSORTb v3.0 on PfGW456L13_4635 Lysine-arginine-ornithine-binding periplasmic protein precursor (TC 3.A.1.3.1) (260 amino acids)

SeqID: PfGW456L13_4635 Lysine-arginine-ornithine-binding periplasmic protein precursor (TC 3.A.1.3.1)
  Analysis Report:
    CMSVM-            Unknown                       [No details]
    CytoSVM-          Unknown                       [No details]
    ECSVM-            Unknown                       [No details]
    ModHMM-           Unknown                       [No internal helices found]
    Motif-            Periplasmic                   [matched PS01039: SBP_BACTERIAL_3 Pattern - Periplasmic]
    OMPMotif-         Unknown                       [No motifs found]
    OMSVM-            Unknown                       [No details]
    PPSVM-            Periplasmic                   [No details]
    Profile-          Unknown                       [No matches to profiles found]
    SCL-BLAST-        Periplasmic                   [matched 20141196: Lysine-arginine-ornithine-binding periplasmic protein precursor]
    SCL-BLASTe-       Unknown                       [No matches against database]
    Signal-           Non-Cytoplasmic               [Signal peptide detected]
  Localization Scores:
    Periplasmic            10.00
    Extracellular          0.00
    CytoplasmicMembrane    0.00
    OuterMembrane          0.00
    Cytoplasmic            0.00
  Final Prediction:
    Periplasmic            10.00

-------------------------------------------------------------------------------

Other sequence analysis tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in the ENIGMA genome browser

Input

>PfGW456L13_4635 Lysine-arginine-ornithine-binding periplasmic protein precursor (TC 3.A.1.3.1)
MKKALLTLSALALCMAAGSAMAKEYKELRFGVDPSYAPFESKAADGSLVGFDIDLGNAIC
AELKVKCKWVESDFDGMIPGLKANKFDGVISSMTVTPAREKVIDFSSELFSGPTAYVFKK
GSGLTEDVASLKGKTVGYEQGTIQEAYAKAVLDKAGVKTQAYQNQDQVYSDLTSGRLDAA
IQDMLQAELGFLKSPKGEGYEVSKPVDSELLPAKTAVGIKKGNTELKALLDKGIKALHDD
GTYATIQKKHFGDLNLYSGK