PSORTb v3.0 (Gram-negative)

Running PSORTb v3.0 on RR42_RS17360 FitnessBrowser__Cup4G11:RR42_RS17360 (274 amino acids)

SeqID: RR42_RS17360 FitnessBrowser__Cup4G11:RR42_RS17360
  Analysis Report:
    CMSVM-            Unknown                       [No details]
    CytoSVM-          Unknown                       [No details]
    ECSVM-            Unknown                       [No details]
    ModHMM-           Unknown                       [1 internal helix found]
    Motif-            Unknown                       [No motifs found]
    OMPMotif-         Unknown                       [No motifs found]
    OMSVM-            Unknown                       [No details]
    PPSVM-            Unknown                       [No details]
    Profile-          Unknown                       [No matches to profiles found]
    SCL-BLAST-        Cytoplasmic                   [matched 71159808: Pyrroline-5-carboxylate reductase]
    SCL-BLASTe-       Unknown                       [No matches against database]
    Signal-           Unknown                       [No signal peptide detected]
  Localization Scores:
    Cytoplasmic            9.26
    Periplasmic            0.48
    CytoplasmicMembrane    0.24
    OuterMembrane          0.01
    Extracellular          0.01
  Final Prediction:
    Cytoplasmic            9.26

-------------------------------------------------------------------------------

Other sequence analysis tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in the ENIGMA genome browser

Input

>RR42_RS17360 FitnessBrowser__Cup4G11:RR42_RS17360
MLKTLTFGFLGGGNMATALIGGLIARGVPATSIRVVDPFDEAQARLRRDLGVHAAGAPDT
AFGKSDVLVLAVKPQQFREAAAALLPHLGDSLIVSVAAGIRLADMQRWFGGRTRLVRAMP
NTPALAGMGMTGLAAVAGLAQQDRDIASALAEAVGKCEWVEGDAQIDAVTAISGSGPAYV
FYFIEAMEKAAVELGLSAAQGRALAVETFRGAAALAAQSEEPVSLLRERVTSKGGTTYAA
LTAMQAAGIGEAFVKAMRAAAERATEMGAEFGKD