PSORTb v3.0 (Gram-negative)

Running PSORTb v3.0 on SM_b20706 FitnessBrowser__Smeli:SM_b20706 (258 amino acids)

SeqID: SM_b20706 FitnessBrowser__Smeli:SM_b20706
  Analysis Report:
    CMSVM-            Unknown                       [No details]
    CytoSVM-          Unknown                       [No details]
    ECSVM-            Unknown                       [No details]
    ModHMM-           Unknown                       [No internal helices found]
    Motif-            Periplasmic                   [matched PS01039: SBP_BACTERIAL_3 Pattern - Periplasmic]
    OMPMotif-         Unknown                       [No motifs found]
    OMSVM-            Unknown                       [No details]
    PPSVM-            Unknown                       [No details]
    Profile-          Unknown                       [No matches to profiles found]
    SCL-BLAST-        Periplasmic                   [matched 15599060: probable amino acid binding protein[Pseudomonas aeruginosa PAO1]]
    SCL-BLASTe-       Unknown                       [No matches against database]
    Signal-           Non-Cytoplasmic               [Signal peptide detected]
  Localization Scores:
    Periplasmic            10.00
    Extracellular          0.00
    CytoplasmicMembrane    0.00
    OuterMembrane          0.00
    Cytoplasmic            0.00
  Final Prediction:
    Periplasmic            10.00

-------------------------------------------------------------------------------

Other sequence analysis tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in the ENIGMA genome browser

Input

>SM_b20706 FitnessBrowser__Smeli:SM_b20706
MRKLILALALAGTALSSSAVAAEKLKIGTEGAYPPFNFVDSSGKIGGFDVEIGLALCERM
KVECEVVAQDWDGIIPGLLAKKYDMIIASMFITEERKKQVAFTNPYYLAAMTHAAPKGAG
ISAFSNEALQGKVIGAQSGTTQADYIAAVYPDAEIKLYPTQDEANLDMVNGRLDLQVGDM
LPLLDWVTKNDDGKGCCELVGEPITDKKFVGDGVGIAVRQEDNEMREKLNKALDEIRADG
TYKKINDKYFTIDVYTMK

by Morgan Price, Arkin group
Lawrence Berkeley National Laboratory