PSORTb v3.0 (Gram-negative)

Running PSORTb v3.0 on SMa0329 FitnessBrowser__Smeli:SMa0329 (253 amino acids)

SeqID: SMa0329 FitnessBrowser__Smeli:SMa0329
  Analysis Report:
    CMSVM-            Unknown                       [No details]
    CytoSVM-          Unknown                       [No details]
    ECSVM-            Unknown                       [No details]
    ModHMM-           Unknown                       [No internal helices found]
    Motif-            Unknown                       [No motifs found]
    OMPMotif-         Unknown                       [No motifs found]
    OMSVM-            Unknown                       [No details]
    PPSVM-            Unknown                       [No details]
    Profile-          Unknown                       [No matches to profiles found]
    SCL-BLAST-        Cytoplasmic                   [matched 15597025: probable short-chain dehydrogenase[Pseudomonas aeruginosa PAO1]]
    SCL-BLASTe-       Unknown                       [No matches against database]
    Signal-           Unknown                       [No signal peptide detected]
  Localization Scores:
    Cytoplasmic            9.26
    Periplasmic            0.48
    CytoplasmicMembrane    0.24
    OuterMembrane          0.01
    Extracellular          0.01
  Final Prediction:
    Cytoplasmic            9.26

-------------------------------------------------------------------------------

Other sequence analysis tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in the ENIGMA genome browser

Input

>SMa0329 FitnessBrowser__Smeli:SMa0329
MSKRFDGKVAIVTGGGSGIGAAIANRLLEEGASVMMSGRTEKRLSDVASKMPADRSGIFV
ANVSSRPDCDALVAATVERFGRIDTVVNAAGMNFVGTIQETSDQDWDECIASDLSGVFYM
SRAAVPHLKETKGSIVNIGSVSSLGGGWSHAAYNAAKGGVANLTRSAACDLGKFGVRANT
VAPGLTVTGMVEAIMDDDALLEKAWDRIPLRRAGQPASAVAFLASDEAAWITGIVLPVDG
GQTCTDGGPEWGK