PSORTb v3.0 (Gram-negative)

Running PSORTb v3.0 on SMa1462 FitnessBrowser__Smeli:SMa1462 (296 amino acids)

SeqID: SMa1462 FitnessBrowser__Smeli:SMa1462
  Analysis Report:
    CMSVM-            Unknown                       [No details]
    CytoSVM-          Unknown                       [No details]
    ECSVM-            Unknown                       [No details]
    ModHMM-           Unknown                       [1 internal helix found]
    Motif-            Unknown                       [No motifs found]
    OMPMotif-         Unknown                       [No motifs found]
    OMSVM-            Unknown                       [No details]
    PPSVM-            Unknown                       [No details]
    Profile-          Unknown                       [No matches to profiles found]
    SCL-BLAST-        CytoplasmicMembrane           [matched 16080424: choline ABC transporter (choline-binding protein) [Bacillus subtilis subsp. subtilis str. 168]]
    SCL-BLASTe-       Unknown                       [No matches against database]
    Signal-           Non-Cytoplasmic               [Signal peptide detected]
  Localization Scores:
    CytoplasmicMembrane    9.97
    Periplasmic            0.01
    Extracellular          0.01
    OuterMembrane          0.01
    Cytoplasmic            0.00
  Final Prediction:
    CytoplasmicMembrane    9.97

-------------------------------------------------------------------------------

Other sequence analysis tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in the ENIGMA genome browser

Input

>SMa1462 FitnessBrowser__Smeli:SMa1462
MNFAPKLAKTLLSAAAIALVTTTAWAATITVGGKNFTEQLIIAEITKQLLESKGHTVDKK
DGMGTKIVRAALENGEVDLYWEYTGTSLITFNKVTERLSPEETYNRVKELDGEKGLVWLA
PSAANNTYAYVVKPGNAKTEGMETISDLAKAYNDGKDILMGTTAEFPKRPDGLIGLEKVY
GFETGRANVRPMDLGLAYNALANGDLDTIAAQATDGQIAALGLKTLKDDKGFFPNYALTP
VVRKEVLDANPDLKETLETVSKKLDDATMQRLNSQVDVEKKTIETVAADYLKSLGM