PSORTb v3.0 (Gram-negative)

Running PSORTb v3.0 on SMc01232 FitnessBrowser__Smeli:SMc01232 (209 amino acids)

SeqID: SMc01232 FitnessBrowser__Smeli:SMc01232
  Analysis Report:
    CMSVM-            CytoplasmicMembrane           [No details]
    CytoSVM-          Unknown                       [No details]
    ECSVM-            Unknown                       [No details]
    ModHMM-           CytoplasmicMembrane           [6 internal helices found]
    Motif-            Unknown                       [No motifs found]
    OMPMotif-         Unknown                       [No motifs found]
    OMSVM-            Unknown                       [No details]
    PPSVM-            Unknown                       [No details]
    Profile-          Unknown                       [No matches to profiles found]
    SCL-BLAST-        CytoplasmicMembrane           [matched 54042636: UPF0056 inner membrane protein yhgN]
    SCL-BLASTe-       Unknown                       [No matches against database]
    Signal-           Unknown                       [No signal peptide detected]
  Localization Scores:
    CytoplasmicMembrane    10.00
    Cytoplasmic            0.00
    Periplasmic            0.00
    Extracellular          0.00
    OuterMembrane          0.00
  Final Prediction:
    CytoplasmicMembrane    10.00

-------------------------------------------------------------------------------

Other sequence analysis tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in the ENIGMA genome browser

Input

>SMc01232 FitnessBrowser__Smeli:SMc01232
MFDVDLLINALTTLLVTLDPPGLAPIFLSLTVGLSRQQRFQVATRGSLIAFFILAAFALF
GDGILGLLGISIGAFRIAGGMLLFWIAFEMIFEKRQERKEKAGETAITKDHLHNIAVFPL
ALPLIAGPGAISATILLGSSFPSALERVQLIVVIAASMAILFLALVIAERIDRFLGVTGR
AILTRLLGVILAALAVQFVVDGVRSAFQV

by Morgan Price, Arkin group
Lawrence Berkeley National Laboratory