PSORTb v3.0 (Gram-negative)

Running PSORTb v3.0 on SMc03103 SMc03103 carbon monoxide dehydrogenase medium subunit transmembrane protein (265 amino acids)

SeqID: SMc03103 SMc03103 carbon monoxide dehydrogenase medium subunit transmembrane protein
  Analysis Report:
    CMSVM-            Unknown                       [No details]
    CytoSVM-          Unknown                       [No details]
    ECSVM-            Unknown                       [No details]
    ModHMM-           Unknown                       [No internal helices found]
    Motif-            Unknown                       [No motifs found]
    OMPMotif-         Unknown                       [No motifs found]
    OMSVM-            Unknown                       [No details]
    PPSVM-            Unknown                       [No details]
    Profile-          Unknown                       [No matches to profiles found]
    SCL-BLAST-        Unknown                       [No matches against database]
    SCL-BLASTe-       Unknown                       [No matches against database]
    Signal-           Unknown                       [No signal peptide detected]
  Localization Scores:
    CytoplasmicMembrane    2.00
    Cytoplasmic            2.00
    OuterMembrane          2.00
    Periplasmic            2.00
    Extracellular          2.00
  Final Prediction:
    Unknown

-------------------------------------------------------------------------------

Other sequence analysis tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in the ENIGMA genome browser

Input

>SMc03103 SMc03103 carbon monoxide dehydrogenase medium subunit transmembrane protein
MYETNYHRASSVEEAANLMGTAAEGKYLSGGMTLIPTMKQRLAAPSDLVDLRHIAEMKGI
TVDGRSVRIGAATTHEEVATSAALAAACPAICGLASHIGDPHVRHMGTIGGSIANNDPAA
DYPAAMLALDAVIVTDRREVKAEDFFTGLFETALEDGEIVTAVRFEAPAKAAYQKFPNPA
SRYAMTGVFVVRRDDGGVRVAVTGAGSDGVFRHRDLEAALAANWSPGAVANVQVDDSDLL
SDIHASAAYRANLVKVMTKRAVAAA

by Morgan Price, Arkin group
Lawrence Berkeley National Laboratory