PSORTb v3.0 (Gram-negative)

Running PSORTb v3.0 on Synpcc7942_B2663 FitnessBrowser__SynE:Synpcc7942_B2663 (319 amino acids)

SeqID: Synpcc7942_B2663 FitnessBrowser__SynE:Synpcc7942_B2663
  Analysis Report:
    CMSVM-            Unknown                       [No details]
    CytoSVM-          Cytoplasmic                   [No details]
    ECSVM-            Unknown                       [No details]
    ModHMM-           Unknown                       [No internal helices found]
    Motif-            Unknown                       [No motifs found]
    OMPMotif-         Unknown                       [No motifs found]
    OMSVM-            Unknown                       [No details]
    PPSVM-            Unknown                       [No details]
    Profile-          Unknown                       [No matches to profiles found]
    SCL-BLAST-        Cytoplasmic                   [matched 2494014: Serine acetyltransferase, plasmid]
    SCL-BLASTe-       Cytoplasmic                   [matched 100% 2494014: Serine acetyltransferase, plasmid]
    Signal-           Unknown                       [No signal peptide detected]
  Localization Scores:
    Cytoplasmic            10.00
    CytoplasmicMembrane    0.00
    OuterMembrane          0.00
    Periplasmic            0.00
    Extracellular          0.00
  Final Prediction:
    Cytoplasmic            10.00

-------------------------------------------------------------------------------

Other sequence analysis tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in the ENIGMA genome browser

Input

>Synpcc7942_B2663 FitnessBrowser__SynE:Synpcc7942_B2663
MSLSPRSDRTEIRRSWGLDSIVSALSQASTDPLPHHLLSDQFYPLPSRESLGLILHGLRS
VLFPRHFGDPELSVETTHYFIGNTLDKTLNLLNEQIRRELWLQHVTQGTPEATPAVLSQH
ASELTQAFAQALPEIKRLLDSDVNAAYLGDPAAQSISEILFCYPGITAITFHRLAHRLYQ
LGLPLLARITAEVSHSETGIDIHPGAAIGGSFFIDHGTGVVIGETCVIGDRVRIYQAVTL
GAKSFPRDETGALIKGQARHPVIEDDVVIYAGATLLGRITVGRGSTIGGNVWLTRSVPAG
SFISQAQIRSDNFESGGGI

by Morgan Price, Arkin group
Lawrence Berkeley National Laboratory