PSORTb v3.0 (Gram-negative)

Running PSORTb v3.0 on WP_011384963.1 AMB_RS12995 C4-dicarboxylate ABC transporter substrate-binding protein (187 amino acids)

SeqID: WP_011384963.1 AMB_RS12995 C4-dicarboxylate ABC transporter substrate-binding protein
  Analysis Report:
    CMSVM-            CytoplasmicMembrane           [No details]
    CytoSVM-          Unknown                       [No details]
    ECSVM-            Unknown                       [No details]
    ModHMM-           CytoplasmicMembrane           [3 internal helices found]
    Motif-            Unknown                       [No motifs found]
    OMPMotif-         Unknown                       [No motifs found]
    OMSVM-            Unknown                       [No details]
    PPSVM-            Unknown                       [No details]
    Profile-          Unknown                       [No matches to profiles found]
    SCL-BLAST-        Unknown                       [No matches against database]
    SCL-BLASTe-       Unknown                       [No matches against database]
    Signal-           Unknown                       [No signal peptide detected]
  Localization Scores:
    CytoplasmicMembrane    10.00
    Periplasmic            0.00
    Extracellular          0.00
    OuterMembrane          0.00
    Cytoplasmic            0.00
  Final Prediction:
    CytoplasmicMembrane    10.00

-------------------------------------------------------------------------------

Other sequence analysis tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in the ENIGMA genome browser

Input

>WP_011384963.1 AMB_RS12995 C4-dicarboxylate ABC transporter substrate-binding protein
MKPLLALSSLIDRINEWVGRSVYWLILLMVIVSSGNATIRYIFSNSSNAWLEVQWYLFAA
VFLLCAGYTLLKNEHIRIDVIAGRLPRRTQIWIDILGTLVFLFPMALLILTLSWPMFMKS
FTMMEMSSDAGGLIRWPVKLLLPVGFSLLMLQGVSELIKKIAILTGDLADPGDHGHHHHT
SADGEAA