PSORTb v3.0 (Gram-negative)

Running PSORTb v3.0 on WP_011648866.1 NCBI__GCF_000009265.1:WP_011648866.1 (279 amino acids)

SeqID: WP_011648866.1 NCBI__GCF_000009265.1:WP_011648866.1
  Analysis Report:
    CMSVM-            Unknown                       [No details]
    CytoSVM-          Unknown                       [No details]
    ECSVM-            Unknown                       [No details]
    ModHMM-           Unknown                       [No internal helices found]
    Motif-            Periplasmic                   [matched PS01039: SBP_BACTERIAL_3 Pattern - Periplasmic]
    OMPMotif-         Unknown                       [No motifs found]
    OMSVM-            Unknown                       [No details]
    PPSVM-            Unknown                       [No details]
    Profile-          Unknown                       [No matches to profiles found]
    SCL-BLAST-        OuterMembrane                 [matched 1172055: Major cell-binding factor precursor]
    SCL-BLASTe-       Unknown                       [No matches against database]
    Signal-           Non-Cytoplasmic               [Signal peptide detected]
  Localization Scores:
    Periplasmic            7.50
    OuterMembrane          2.49
    Extracellular          0.01
    CytoplasmicMembrane    0.00
    Cytoplasmic            0.00
  Final Prediction:
    Periplasmic            7.50

-------------------------------------------------------------------------------

Other sequence analysis tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in the ENIGMA genome browser

Input

>WP_011648866.1 NCBI__GCF_000009265.1:WP_011648866.1
MTISFRTGVMSLAVAALLSTPALAEGSKLDEVLARGHLVLGTGSTNAPWHFKSADDKLQG
FDVDMGHIIAKALFGDPEKIEYVNQSSDARIPNITTDKVDITCQFMTVTGERAQQVAFTI
PYYREGVGLMLKADGKYADYAALKAAGSSVTISVLQNVYAEAMVHAALPEATVDQYDSVD
LIYQALESGRADAVATDQSSLAWYMTQNPGRYKDAGYGWNPQTYACAVKRGDQDWLNFVN
TALHEAMTGVEFDFYAKSFKTWFGKDLAPPQIGFPVEFK