Running PSORTb v3.0 on WP_011736886.1 NCBI__GCF_000015045.1:WP_011736886.1 (253 amino acids)
SeqID: WP_011736886.1 NCBI__GCF_000015045.1:WP_011736886.1 Analysis Report: CMSVM- Unknown [No details] CytoSVM- Cytoplasmic [No details] ECSVM- Unknown [No details] ModHMM- Unknown [No internal helices found] Motif- Periplasmic [matched PS01039: SBP_BACTERIAL_3 Pattern - Periplasmic] OMPMotif- Unknown [No motifs found] OMSVM- Unknown [No details] PPSVM- Unknown [No details] Profile- Unknown [No matches to profiles found] SCL-BLAST- Cytoplasmic [matched 20455028: Imidazole glycerol phosphate synthase subunit hisF] SCL-BLASTe- Unknown [No matches against database] Signal- Unknown [No signal peptide detected] Localization Scores: Periplasmic 6.00 Cytoplasmic 4.00 CytoplasmicMembrane 0.01 Extracellular 0.00 OuterMembrane 0.00 Final Prediction: Unknown (This protein may have multiple localization sites.) -------------------------------------------------------------------------------
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in the ENIGMA genome browser
>WP_011736886.1 NCBI__GCF_000015045.1:WP_011736886.1 MLTKRIIPCLDVKGGRVVKGVQFLELRDAGDPVEIAEIYDRQGADELTFLDITASSDERD IIIDVVRRTAERVFMPLTVGGGIRTVQDIRRLLNAGADKTSINTAAVHRPEFVREAAERF GSQCTVVAIDARRVPGEKRWEVYTHGGRNPTGIDAVEWAVRMEEFGSGEILLTSMDCDGT KDGYDLELTRAVVDAVSIPVIASGGVGNLEHLYDGFAQGGASACLAASIFHYREYSIGEA KQYLKERGVPVRL
Lawrence Berkeley National Laboratory