Running PSORTb v3.0 on WP_011969870.1 NCBI__GCF_000017145.1:WP_011969870.1 (298 amino acids)
SeqID: WP_011969870.1 NCBI__GCF_000017145.1:WP_011969870.1 Analysis Report: CMSVM- Unknown [No details] CytoSVM- Unknown [No details] ECSVM- Extracellular [No details] ModHMM- Unknown [No internal helices found] Motif- Unknown [No motifs found] OMPMotif- Unknown [No motifs found] OMSVM- Unknown [No details] PPSVM- Unknown [No details] Profile- Unknown [No matches to profiles found] SCL-BLAST- Cytoplasmic [matched 15598765: Cytoplasmic protein] SCL-BLASTe- Unknown [No matches against database] Signal- Unknown [No signal peptide detected] Localization Scores: Extracellular 3.91 Cytoplasmic 3.76 Periplasmic 2.14 CytoplasmicMembrane 0.10 OuterMembrane 0.09 Final Prediction: Unknown -------------------------------------------------------------------------------
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in the ENIGMA genome browser
>WP_011969870.1 NCBI__GCF_000017145.1:WP_011969870.1 MTKIAFIGLGNMGGPMAANLVKAGHAVTGFDLLEASRNAAAKSGVSVAGSIAQAVREMEC VITMLPASAHVLYVWDELLGFVDPGTLLIDSSTIDVESARKVHGLAEKANCPSLDAPVSG GTAGAAGATLTFMVGGSDGAFSRGKHLLEAMGKKIVHCGDAGAGQAAKICNNMILGVSMA AVCEAFVLAERLGLSHQALFDVASTSSGQCWSLTTYCPVPGPVPTSPANSGYKPGFAASL MLKDLKLSQQAASASGAATPMGAQAMQLYSLFEKLGHGSEDFSALIHLLRGNEEGKAE
Lawrence Berkeley National Laboratory