Running PSORTb v3.0 on WP_024981057.1 NCBI__GCF_002017945.1:WP_024981057.1 (220 amino acids)
SeqID: WP_024981057.1 NCBI__GCF_002017945.1:WP_024981057.1 Analysis Report: CMSVM- Unknown [No details] CytoSVM- Cytoplasmic [No details] ECSVM- Unknown [No details] ModHMM- Unknown [No internal helices found] Motif- Unknown [No motifs found] OMPMotif- Unknown [No motifs found] OMSVM- Unknown [No details] PPSVM- Unknown [No details] Profile- Unknown [No matches to profiles found] SCL-BLAST- CytoplasmicMembrane [matched 3915974: Lipoprotein-releasing system ATP-binding protein lolD] SCL-BLASTe- Unknown [No matches against database] Signal- Unknown [No signal peptide detected] Localization Scores: CytoplasmicMembrane 7.88 Cytoplasmic 2.11 Periplasmic 0.00 Extracellular 0.00 OuterMembrane 0.00 Final Prediction: CytoplasmicMembrane 7.88 -------------------------------------------------------------------------------
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in the ENIGMA genome browser
>WP_024981057.1 NCBI__GCF_002017945.1:WP_024981057.1 MILAKNIHKFYDQLEVLKGVDLHITKGEIVSIVGASGAGKTTLLQILGTLDRPTSNENSS LLINGEDVLKMNDKALSRFRNLNLGFIFQFHQLLPEFTALENVCIPAFIAGKNKLETEIE AKKLLDYLGLSHRHHHKPNELSGGEQQRVAVARALINKPDILFADEPSGNLDTTSAENLH QLFFKLRDELGQTFVIVTHNEELANMADRKLVMVDGQISA
Lawrence Berkeley National Laboratory