Running PSORTb v3.0 on WP_037571347.1 NCBI__GCF_000744815.1:WP_037571347.1 (277 amino acids)
SeqID: WP_037571347.1 NCBI__GCF_000744815.1:WP_037571347.1 Analysis Report: CMSVM- CytoplasmicMembrane [No details] CytoSVM- Unknown [No details] ECSVM- Unknown [No details] ModHMM- CytoplasmicMembrane [6 internal helices found] Motif- CytoplasmicMembrane [matched PS00221: MIP Pattern - Cytoplasmic Membrane] OMPMotif- Unknown [No motifs found] OMSVM- Unknown [No details] PPSVM- Unknown [No details] Profile- Unknown [No matches to profiles found] SCL-BLAST- CytoplasmicMembrane [matched 20141735: Propanediol diffusion facilitator] SCL-BLASTe- Unknown [No matches against database] Signal- Non-Cytoplasmic [Signal peptide detected] Localization Scores: CytoplasmicMembrane 10.00 Periplasmic 0.00 Extracellular 0.00 OuterMembrane 0.00 Cytoplasmic 0.00 Final Prediction: CytoplasmicMembrane 10.00 -------------------------------------------------------------------------------
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in the ENIGMA genome browser
>WP_037571347.1 NCBI__GCF_000744815.1:WP_037571347.1 MASPAKPAGRPALNPLLGELVAEFLGTMILILIGCGVVAQVVAAGIGGHDSIAWAWGLGV TFGVYVAGRLSGAHLNPAVTVTLAAFRGFPWRKVLPYSLAQFAGAFCAALLVRWNYTEVL AKADPGHTLKTQIVFSTLPGNGTLPISEWGALRDQIIGTSILLFVIMALTDLLNTPPLAN MGGFVIGLLIVAIGFAWGTDDGYAINPARDFGPRLASFLTGYGGAWRDQYGDLFFWVPIV GPLIGGVVGGAFYRYLVQPFVVQKDALEVAARELEEG
Lawrence Berkeley National Laboratory