Running PSORTb v3.0 on WP_086508344.1 NCBI__GCF_002151265.1:WP_086508344.1 (261 amino acids)
SeqID: WP_086508344.1 NCBI__GCF_002151265.1:WP_086508344.1 Analysis Report: CMSVM- Unknown [No details] CytoSVM- Cytoplasmic [No details] ECSVM- Unknown [No details] ModHMM- Unknown [No internal helices found] Motif- Periplasmic [matched PS01039: SBP_BACTERIAL_3 Pattern - Periplasmic] OMPMotif- Unknown [No motifs found] OMSVM- Unknown [No details] PPSVM- Unknown [No details] Profile- Unknown [No matches to profiles found] SCL-BLAST- Periplasmic [matched 15599060: probable amino acid binding protein[Pseudomonas aeruginosa PAO1]] SCL-BLASTe- Unknown [No matches against database] Signal- Non-Cytoplasmic [Signal peptide detected] Localization Scores: Periplasmic 10.00 CytoplasmicMembrane 0.00 Extracellular 0.00 OuterMembrane 0.00 Cytoplasmic 0.00 Final Prediction: Periplasmic 10.00 -------------------------------------------------------------------------------
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in the ENIGMA genome browser
>WP_086508344.1 NCBI__GCF_002151265.1:WP_086508344.1 MRALNMILAATLAAGLTAGTAQARDYSEIRLGVDIPYEPFMYRQPDGELTGFEIELGNAV CEYLEVTCTWVEQDWDGIIPGLMARNYDAIMSSMAITEERAERVLFSEPYYTTPSAWITT RDRDIDIEDRDSLAGLVVGVQRATLQDNYVSELYGDLVEIRRYTSADDVVTDMRAGRLDL TFMDYPVAENTMGIDTSGSHFKRISGFIKEPEHIFGKGVGVAFRQRDEALAERFNEALAA LKEDGTYDEIMERYFNYDIKL
Lawrence Berkeley National Laboratory