Comparing 14155 FitnessBrowser__Keio:14155 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 4 hits to proteins with known functional sites (download)
P0AC98 Succinate-acetate/proton symporter SatP; Succinate-acetate transporter protein from Escherichia coli (strain K12) (see paper)
100% identity, 100% coverage: 1:188/188 of query aligns to 1:188/188 of P0AC98
5ys3A 1.8 angstrom crystal structure of succinate-acetate permease from citrobacter koseri (see paper)
92% identity, 98% coverage: 5:188/188 of query aligns to 1:184/188 of 5ys3A
5ys8A 2.8 angstrom crystal structure of succinate-acetate permease from citrobacter koseri (see paper)
92% identity, 97% coverage: 6:187/188 of query aligns to 1:182/182 of 5ys8A
P41943 Glyoxylate pathway regulator from Yarrowia lipolytica (strain CLIB 122 / E 150) (Yeast) (Candida lipolytica) (see paper)
37% identity, 84% coverage: 3:159/188 of query aligns to 74:236/270 of P41943
Sites not aligning to the query:
>14155 FitnessBrowser__Keio:14155
MGNTKLANPAPLGLMGFGMTTILLNLHNVGYFALDGIILAMGIFYGGIAQIFAGLLEYKK
GNTFGLTAFTSYGSFWLTLVAILLMPKLGLTDAPNAQFLGVYLGLWGVFTLFMFFGTLKG
ARVLQFVFFSLTVLFALLAIGNIAGNAAIIHFAGWIGLICGASAIYLAMGEVLNEQFGRT
VLPIGESH
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory