Comparing 14297 FitnessBrowser__Keio:14297 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
P07821 Iron(3+)-hydroxamate import ATP-binding protein FhuC; Ferric hydroxamate uptake protein C; Ferrichrome transport ATP-binding protein FhuC; Iron(III)-hydroxamate import ATP-binding protein FhuC; EC 7.2.2.16 from Escherichia coli (strain K12) (see 2 papers)
100% identity, 100% coverage: 1:265/265 of query aligns to 1:265/265 of P07821
P30750 Methionine import ATP-binding protein MetN; EC 7.4.2.11 from Escherichia coli (strain K12) (see 3 papers)
33% identity, 85% coverage: 12:236/265 of query aligns to 2:229/343 of P30750
Sites not aligning to the query:
3tuzC Inward facing conformations of the metni methionine abc transporter: cy5 semet soak crystal form (see paper)
32% identity, 85% coverage: 12:236/265 of query aligns to 3:230/344 of 3tuzC
Sites not aligning to the query:
3tuiC Inward facing conformations of the metni methionine abc transporter: cy5 native crystal form (see paper)
32% identity, 85% coverage: 12:236/265 of query aligns to 3:230/344 of 3tuiC
6cvlD Crystal structure of the escherichia coli atpgs-bound metni methionine abc transporter in complex with its metq binding protein (see paper)
32% identity, 84% coverage: 14:236/265 of query aligns to 5:230/344 of 6cvlD
1l7vC Bacterial abc transporter involved in b12 uptake (see paper)
34% identity, 86% coverage: 21:247/265 of query aligns to 9:231/231 of 1l7vC
4fi3C Structure of vitamin b12 transporter btucd-f in a nucleotide-bound state (see paper)
34% identity, 86% coverage: 21:247/265 of query aligns to 9:231/248 of 4fi3C
7ph2A Nanodisc reconstituted msba in complex with nanobodies, spin-labeled at position a60c (see paper)
31% identity, 84% coverage: 14:236/265 of query aligns to 333:555/569 of 7ph2A
Sites not aligning to the query:
8dmmA Structure of the vanadate-trapped msba bound to kdl (see paper)
31% identity, 84% coverage: 14:236/265 of query aligns to 340:562/576 of 8dmmA
Sites not aligning to the query:
P60752 ATP-dependent lipid A-core flippase; Lipid A export ATP-binding/permease protein MsbA; Lipid flippase; EC 7.5.2.6 from Escherichia coli (strain K12) (see 7 papers)
31% identity, 84% coverage: 14:236/265 of query aligns to 344:566/582 of P60752
Sites not aligning to the query:
7ph3A Amp-pnp bound nanodisc reconstituted msba with nanobodies, spin- labeled at position a60c (see paper)
31% identity, 84% coverage: 14:236/265 of query aligns to 342:564/577 of 7ph3A
7bcwA Structure of msba in salipro with adp vanadate (see paper)
31% identity, 84% coverage: 14:236/265 of query aligns to 339:561/574 of 7bcwA
6bppA E. Coli msba in complex with lps and inhibitor g092 (see paper)
31% identity, 84% coverage: 14:236/265 of query aligns to 341:563/576 of 6bppA
Sites not aligning to the query:
6bplA E. Coli msba in complex with lps and inhibitor g907 (see paper)
31% identity, 84% coverage: 14:236/265 of query aligns to 341:563/576 of 6bplA
Sites not aligning to the query:
7mewA E. Coli msba in complex with g247 (see paper)
31% identity, 84% coverage: 14:236/265 of query aligns to 337:559/572 of 7mewA
Sites not aligning to the query:
8bmpA Cryo-em structure of the folate-specific ecf transporter complex in msp2n2 lipid nanodiscs bound to atp and adp (see paper)
32% identity, 92% coverage: 8:251/265 of query aligns to 2:241/278 of 8bmpA
5d3mA Folate ecf transporter: amppnp bound state (see paper)
32% identity, 92% coverage: 8:251/265 of query aligns to 2:244/280 of 5d3mA
4hluC Structure of the ecfa-a' heterodimer bound to adp (see paper)
33% identity, 85% coverage: 14:239/265 of query aligns to 7:223/249 of 4hluC
3c4jA Abc protein artp in complex with atp-gamma-s
32% identity, 80% coverage: 26:236/265 of query aligns to 18:226/242 of 3c4jA
Sites not aligning to the query:
3c41J Abc protein artp in complex with amp-pnp/mg2+
32% identity, 80% coverage: 26:236/265 of query aligns to 18:226/242 of 3c41J
Sites not aligning to the query:
>14297 FitnessBrowser__Keio:14297
MQEYTNHSDTTFALRNISFRVPGRTLLHPLSLTFPAGKVTGLIGHNGSGKSTLLKMLGRH
QPPSEGEILLDAQPLESWSSKAFARKVAYLPQQLPPAEGMTVRELVAIGRYPWHGALGRF
GAADREKVEEAISLVGLKPLAHRLVDSLSGGERQRAWIAMLVAQDSRCLLLDEPTSALDI
AHQVDVLSLVHRLSQERGLTVIAVLHDINMAARYCDYLVALRGGEMIAQGTPAEIMRGET
LEMIYGIPMGILPHPAGAAPVSFVY
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory