Comparing 14332 FitnessBrowser__Keio:14332 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 9 hits to proteins with known functional sites (download)
6q7lA Inducible lysine decarboxylase (see paper)
69% identity, 100% coverage: 1:710/713 of query aligns to 1:710/711 of 6q7lA
3n75A X-ray crystal structure of the escherichia coli inducible lysine decarboxylase ldci (see paper)
69% identity, 100% coverage: 1:710/713 of query aligns to 1:710/711 of 3n75A
6q6iA Lysine decarboxylase a from pseudomonas aeruginosa
45% identity, 87% coverage: 93:710/713 of query aligns to 114:749/749 of 6q6iA
2vycA Crystal structure of acid induced arginine decarboxylase from e. Coli (see paper)
35% identity, 97% coverage: 19:710/713 of query aligns to 21:754/755 of 2vycA
P28629 Biodegradative arginine decarboxylase; ADC; EC 4.1.1.19 from Escherichia coli (strain K12) (see paper)
35% identity, 97% coverage: 19:710/713 of query aligns to 21:754/755 of P28629
5xx1G Crystal structure of arginine decarboxylase (adia) from salmonella typhimurium (see paper)
34% identity, 97% coverage: 19:710/713 of query aligns to 22:734/735 of 5xx1G
1ordA Crystallographic structure of a plp-dependent ornithine decarboxylase from lactobacillus 30a to 3.1 angstroms resolution (see paper)
31% identity, 90% coverage: 61:703/713 of query aligns to 40:710/730 of 1ordA
1c4kA Ornithine decarboxylase mutant (gly121tyr) (see paper)
33% identity, 82% coverage: 121:703/713 of query aligns to 97:708/728 of 1c4kA
2x3lB Crystal structure of the orn_lys_arg decarboxylase family protein sar0482 from methicillin-resistant staphylococcus aureus (see paper)
21% identity, 50% coverage: 131:487/713 of query aligns to 1:303/423 of 2x3lB
>14332 FitnessBrowser__Keio:14332
MNIIAIMGPHGVFYKDEPIKELESALVAQGFQIIWPQNSVDLLKFIEHNPRICGVIFDWD
EYSLDLCSDINQLNEYLPLYAFINTHSTMDVSVQDMRMALWFFEYALGQAEDIAIRMRQY
TDEYLDNITPPFTKALFTYVKERKYTFCTPGHMGGTAYQKSPVGCLFYDFFGGNTLKADV
SISVTELGSLLDHTGPHLEAEEYIARTFGAEQSYIVTNGTSTSNKIVGMYAAPSGSTLLI
DRNCHKSLAHLLMMNDVVPVWLKPTRNALGILGGIPRREFTRDSIEEKVAATTQAQWPVH
AVITNSTYDGLLYNTDWIKQTLDVPSIHFDSAWVPYTHFHPIYQGKSGMSGERVAGKVIF
ETQSTHKMLAALSQASLIHIKGEYDEEAFNEAFMMHTTTSPSYPIVASVETAAAMLRGNP
GKRLINRSVERALHFRKEVQRLREESDGWFFDIWQPPQVDEAECWPVAPGEQWHGFNDAD
ADHMFLDPVKVTILTPGMDEQGNMSEEGIPAALVAKFLDERGIVVEKTGPYNLLFLFSIG
IDKTKAMGLLRGLTEFKRSYDLNLRIKNMLPDLYAEDPDFYRNMRIQDLAQGIHKLIRKH
DLPGLMLRAFDTLPEMIMTPHQAWQRQIKGEVETIALEQLVGRVSANMILPYPPGVPLLM
PGEMLTKESRTVLDFLLMLCSVGQHYPGFETDIHGAKQDEDGVYRVRVLKMAG
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory