Comparing 14343 FitnessBrowser__Keio:14343 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 13 hits to proteins with known functional sites (download)
4yahX Crystal structure of the methionine binding protein, metq (see paper)
100% identity, 90% coverage: 29:271/271 of query aligns to 1:243/245 of 4yahX
P04846 Lipoprotein 28 from Escherichia coli (strain K12) (see paper)
64% identity, 92% coverage: 23:271/271 of query aligns to 24:272/272 of P04846
3k2dA Crystal structure of immunogenic lipoprotein a from vibrio vulnificus (see paper)
71% identity, 87% coverage: 29:263/271 of query aligns to 4:236/237 of 3k2dA
4qhqA The structure of a nutrient binding protein from burkholderia cenocepacia bound to methionine
55% identity, 88% coverage: 33:271/271 of query aligns to 2:241/241 of 4qhqA
3tqwA Structure of a abc transporter, periplasmic substrate-binding protein from coxiella burnetii (see paper)
50% identity, 87% coverage: 33:268/271 of query aligns to 2:233/235 of 3tqwA
4ib2A Crystal structure of a putative lipoprotein (rumgna_00858) from ruminococcus gnavus atcc 29149 at 1.76 a resolution
41% identity, 89% coverage: 28:268/271 of query aligns to 3:244/247 of 4ib2A
3gxaC Crystal structure of gna1946 (see paper)
44% identity, 78% coverage: 55:265/271 of query aligns to 25:232/244 of 3gxaC
6dzxA Crystal structure of the n. Meningitides methionine-binding protein in its d-methionine bound conformation. (see paper)
44% identity, 78% coverage: 55:265/271 of query aligns to 24:231/240 of 6dzxA
4oteB Crystal structure of a putative lipoprotein (cd630_1653) from clostridium difficile 630 at 2.20 a resolution
38% identity, 88% coverage: 28:265/271 of query aligns to 1:234/240 of 4oteB
1p99A 1.7a crystal structure of protein pg110 from staphylococcus aureus (see paper)
43% identity, 80% coverage: 41:258/271 of query aligns to 13:228/255 of 1p99A
1xs5A The crystal structure of lipoprotein tp32 from treponema pallidum (see paper)
35% identity, 87% coverage: 33:268/271 of query aligns to 5:237/240 of 1xs5A
6jf1A Crystal structure of the substrate binding protein of a methionine transporter from streptococcus pneumoniae (see paper)
38% identity, 82% coverage: 33:255/271 of query aligns to 13:244/260 of 6jf1A
Sites not aligning to the query:
4ntlA Crystal structure of a lipoprotein, yaec family (ef3198) from enterococcus faecalis v583 at 1.80 a resolution
35% identity, 89% coverage: 32:271/271 of query aligns to 3:242/242 of 4ntlA
>14343 FitnessBrowser__Keio:14343
MAFKFKTFAAVGALIGSLALVGCGQDEKDPNHIKVGVIVGAEQQVAEVAQKVAKDKYGLD
VELVTFNDYVLPNEALSKGDIDANAFQHKPYLDQQLKDRGYKLVAVGNTFVYPIAGYSKK
IKSLDELQDGSQVAVPNDPTNLGRSLLLLQKVGLIKLKDGVGLLPTVLDVVENPKNLKIV
ELEAPQLPRSLDDAQIALAVINTTYASQIGLTPAKDGIFVEDKESPYVNLIVTREDNKDA
ENVKKFVQAYQSDEVYEAANKVFNGGAVKGW
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory