Comparing 14406 FitnessBrowser__Keio:14406 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
4ptnA Crystal structure of yage, a kdg aldolase protein in complex with magnesium cation coordinated l-glyceraldehyde (see paper)
100% identity, 99% coverage: 5:302/302 of query aligns to 1:298/298 of 4ptnA
4onvA Crystal structure of yage, a kdg aldolase protein in complex with 2- keto-3-deoxy gluconate
100% identity, 99% coverage: 5:302/302 of query aligns to 1:298/298 of 4onvA
4oe7D Crystal structure of yage, a kdg aldolase protein, in complex with aldol condensed product of pyruvate and glyoxal
100% identity, 99% coverage: 5:302/302 of query aligns to 1:298/298 of 4oe7D
4oe7B Crystal structure of yage, a kdg aldolase protein, in complex with aldol condensed product of pyruvate and glyoxal
100% identity, 99% coverage: 5:302/302 of query aligns to 1:298/298 of 4oe7B
4oe7A Crystal structure of yage, a kdg aldolase protein, in complex with aldol condensed product of pyruvate and glyoxal
100% identity, 99% coverage: 5:302/302 of query aligns to 1:298/298 of 4oe7A
3nevA Crystal structure of yage, a prophage protein from e. Coli k12 in complex with kdgal (see paper)
100% identity, 99% coverage: 5:302/302 of query aligns to 1:298/298 of 3nevA
4i7wA Agrobacterium tumefaciens dhdps with lysine and pyruvate
34% identity, 93% coverage: 6:286/302 of query aligns to 1:280/294 of 4i7wA
Q8UGL3 4-hydroxy-tetrahydrodipicolinate synthase; HTPA synthase; EC 4.3.3.7 from Agrobacterium fabrum (strain C58 / ATCC 33970) (Agrobacterium tumefaciens (strain C58)) (see paper)
36% identity, 80% coverage: 6:246/302 of query aligns to 1:238/294 of Q8UGL3
7mjfA Crystal structure of candidatus liberibacter solanacearum dihydrodipicolinate synthase with pyruvate and succinic semi-aldehyde bound in active site
32% identity, 98% coverage: 6:302/302 of query aligns to 1:294/296 of 7mjfA
7lvlA Dihydrodipicolinate synthase bound with allosteric inhibitor (s)- lysine from candidatus liberibacter solanacearum
32% identity, 98% coverage: 6:302/302 of query aligns to 1:294/296 of 7lvlA
Q9X1K9 4-hydroxy-tetrahydrodipicolinate synthase; HTPA synthase; EC 4.3.3.7 from Thermotoga maritima (strain ATCC 43589 / DSM 3109 / JCM 10099 / NBRC 100826 / MSB8) (see paper)
28% identity, 97% coverage: 6:298/302 of query aligns to 1:290/294 of Q9X1K9
1o5kA Crystal structure of dihydrodipicolinate synthase (tm1521) from thermotoga maritima at 1.80 a resolution
28% identity, 97% coverage: 6:298/302 of query aligns to 2:291/295 of 1o5kA
4dxvA Crystal structure of dihydrodipicolinate synthase from acinetobacter baumannii complexed with mg and cl ions at 1.80 a resolution
34% identity, 71% coverage: 9:221/302 of query aligns to 4:212/291 of 4dxvA
3u8gA Crystal structure of the complex of dihydrodipicolinate synthase from acinetobacter baumannii with oxalic acid at 1.80 a resolution
34% identity, 71% coverage: 9:221/302 of query aligns to 4:212/291 of 3u8gA
3tdfA Crystal structure of the complex of dihydrodipicolinate synthase from acinetobacter baumannii with 2-ketobutanoic acid at 1.99 a resolution
34% identity, 71% coverage: 9:221/302 of query aligns to 4:212/291 of 3tdfA
3tceA Crystal structure of the complex of dihydrodipicolinate synthase from acinetobacter baumannii with 5-hydroxylysine at 2.6 a resolution
34% identity, 71% coverage: 9:221/302 of query aligns to 4:212/291 of 3tceA
3rk8A Crystal structure of the chloride inhibited dihydrodipicolinate synthase from acinetobacter baumannii complexed with pyruvate at 1.8 a resolution
34% identity, 71% coverage: 9:221/302 of query aligns to 4:212/291 of 3rk8A
Sites not aligning to the query:
3pueB Crystal structure of the complex of dhydrodipicolinate synthase from acinetobacter baumannii with lysine at 2.6a resolution
34% identity, 71% coverage: 9:221/302 of query aligns to 4:212/291 of 3pueB
Sites not aligning to the query:
5c55A Crystal structure of the y138f mutant of c.Glutamicum n- acetylneuraminic acid lyase in complex with pyruvate
35% identity, 79% coverage: 7:245/302 of query aligns to 2:242/307 of 5c55A
5t25A Kinetic, spectral and structural characterization of the slow binding inhibitor acetopyruvate with dihydrodipicolinate synthase from escherichia coli.
31% identity, 80% coverage: 6:246/302 of query aligns to 2:238/293 of 5t25A
>14406 FitnessBrowser__Keio:14406
MPQSALFTGIIPPVSTIFTADGQLDKPGTAALIDDLIKAGVDGLFFLGSGGEFSQLGAEE
RKAIARFAIDHVDRRVPVLIGTGGTNARETIELSQHAQQAGADGIVVINPYYWKVSEANL
IRYFEQVADSVTLPVMLYNFPALTGQDLTPALVKTLADSRSNIIGIKDTIDSVAHLRSMI
HTVKGAHPHFTVLCGYDDHLFNTLLLGGDGAISASGNFAPQVSVNLLKAWRDGDVAKAAG
YHQTLLQIPQMYQLDTPFVNVIKEAIVLCGRPVSTHVLPPASPLDEPRKAQLKTLLQQLK
LC
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory