Comparing 14423 FitnessBrowser__Keio:14423 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 10 hits to proteins with known functional sites (download)
P77324 Aldehyde oxidoreductase FAD-binding subunit PaoB; EC 1.2.99.6 from Escherichia coli (strain K12) (see paper)
100% identity, 100% coverage: 1:318/318 of query aligns to 1:318/318 of P77324
5g5gB Escherichia coli periplasmic aldehyde oxidase (see paper)
100% identity, 99% coverage: 1:316/318 of query aligns to 1:316/316 of 5g5gB
5y6qB Crystal structure of an aldehyde oxidase from methylobacillus sp. Ky4400 (see paper)
40% identity, 99% coverage: 1:314/318 of query aligns to 1:326/330 of 5y6qB
O33820 4-hydroxybenzoyl-CoA reductase subunit beta; 4-HBCR subunit beta; EC 1.1.7.1 from Thauera aromatica (see paper)
34% identity, 75% coverage: 28:265/318 of query aligns to 30:263/324 of O33820
Sites not aligning to the query:
1rm6B Structure of 4-hydroxybenzoyl-coa reductase from thauera aromatica (see paper)
34% identity, 75% coverage: 28:265/318 of query aligns to 30:263/323 of 1rm6B
Sites not aligning to the query:
7dqxE Crystal structure of xanthine dehydrogenase family protein
25% identity, 73% coverage: 25:257/318 of query aligns to 28:211/293 of 7dqxE
P19920 Carbon monoxide dehydrogenase medium chain; CO dehydrogenase subunit M; CO-DH M; EC 1.2.5.3 from Afipia carboxidovorans (strain ATCC 49405 / DSM 1227 / KCTC 32145 / OM5) (Oligotropha carboxidovorans) (see 2 papers)
25% identity, 84% coverage: 3:270/318 of query aligns to 5:229/288 of P19920
1n5wC Crystal structure of the cu,mo-co dehydrogenase (codh); oxidized form (see paper)
25% identity, 84% coverage: 3:270/318 of query aligns to 5:229/287 of 1n5wC
1ffuC Carbon monoxide dehydrogenase from hydrogenophaga pseudoflava which lacks the mo-pyranopterin moiety of the molybdenum cofactor (see paper)
33% identity, 35% coverage: 4:113/318 of query aligns to 6:116/287 of 1ffuC
Sites not aligning to the query:
1t3qC Crystal structure of quinoline 2-oxidoreductase from pseudomonas putida 86 (see paper)
25% identity, 83% coverage: 3:267/318 of query aligns to 5:225/285 of 1t3qC
>14423 FitnessBrowser__Keio:14423
MKAFTYERVNTPAEAALSAQRVPGAKFIAGGTNLLDLMKLEIETPTHLIDVNGLGLDKIE
VTDAGGLRIGALVRNTDLAAHERVRRDYAVLSRALLAGASGQLRNQATTAGNLLQRTRCP
YFYDTNQPCNKRLPGSGCAALEGFSRQHAVVGVSEACIATHPSDMAVAMRLLDAVVETIT
PEGKTRSITLADFYHPPGKTPHIETALLPGELIVAVTLPPPLGGKHIYRKVRDRASYAFA
LVSVAAIIQPDGSGRVALGGVAHKPWRIEAADAQLSQGAQAVYDTLFASAHPTAENTFKL
LLAKRTLASVLAEARAQA
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory