SitesBLAST
Comparing 14424 FitnessBrowser__Keio:14424 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
P77165 Aldehyde oxidoreductase iron-sulfur-binding subunit PaoA; EC 1.2.99.6 from Escherichia coli (strain K12) (see paper)
100% identity, 100% coverage: 1:229/229 of query aligns to 1:229/229 of P77165
- C99 (= C99) binding
- C104 (= C104) binding
- G105 (= G105) binding
- C107 (= C107) binding
- C119 (= C119) binding
- C158 (= C158) binding
- C161 (= C161) binding
- C208 (= C208) binding
- C210 (= C210) binding
5g5gA Escherichia coli periplasmic aldehyde oxidase (see paper)
100% identity, 76% coverage: 52:226/229 of query aligns to 1:175/175 of 5g5gA
- binding fe2/s2 (inorganic) cluster: G47 (= G98), C48 (= C99), D49 (= D100), G51 (= G102), C53 (= C104), G54 (= G105), C56 (= C107), C68 (= C119), C107 (= C158), G108 (= G159), C110 (= C161), C157 (= C208), C159 (= C210)
5y6qA Crystal structure of an aldehyde oxidase from methylobacillus sp. Ky4400 (see paper)
56% identity, 74% coverage: 59:227/229 of query aligns to 1:155/157 of 5y6qA
- binding fe2/s2 (inorganic) cluster: G40 (= G98), C41 (= C99), D42 (= D100), G44 (= G102), C46 (= C104), G47 (= G105), C49 (= C107), C61 (= C119), C101 (= C158), G102 (= G159), C104 (= C161), C136 (= C208), C138 (= C210)
- binding pterin cytosine dinucleotide: Q100 (= Q157), C138 (= C210)
4zohC Crystal structure of glyceraldehyde oxidoreductase (see paper)
44% identity, 72% coverage: 61:224/229 of query aligns to 10:157/161 of 4zohC
- binding fe2/s2 (inorganic) cluster: C47 (= C99), S50 (≠ G102), C52 (= C104), G53 (= G105), C55 (= C107), C67 (= C119), C106 (= C158), G107 (= G159), C109 (= C161), C141 (= C208), C143 (= C210)
- binding pterin cytosine dinucleotide: Q105 (= Q157), C143 (= C210)
1t3qA Crystal structure of quinoline 2-oxidoreductase from pseudomonas putida 86 (see paper)
40% identity, 72% coverage: 59:224/229 of query aligns to 2:152/162 of 1t3qA
- binding fe2/s2 (inorganic) cluster: I40 (≠ K97), C42 (= C99), E43 (≠ D100), G45 (= G102), C47 (= C104), G48 (= G105), C50 (= C107), R60 (≠ N117), C62 (= C119), C101 (= C158), G102 (= G159), C104 (= C161), C136 (= C208), C138 (= C210)
- binding pterin cytosine dinucleotide: Q100 (= Q157), C138 (= C210)
1ffuD Carbon monoxide dehydrogenase from hydrogenophaga pseudoflava which lacks the mo-pyranopterin moiety of the molybdenum cofactor (see paper)
40% identity, 72% coverage: 63:228/229 of query aligns to 5:155/156 of 1ffuD
- binding fe2/s2 (inorganic) cluster: C41 (= C99), S44 (≠ G102), H45 (≠ Q103), C46 (= C104), G47 (= G105), C49 (= C107), C61 (= C119), C100 (= C158), G101 (= G159), C103 (= C161), C135 (= C208), C137 (= C210)
1ffvA Carbon monoxide dehydrogenase from hydrogenophaga pseudoflava (see paper)
40% identity, 72% coverage: 63:228/229 of query aligns to 4:154/155 of 1ffvA
- binding fe2/s2 (inorganic) cluster: I38 (≠ K97), C40 (= C99), S43 (≠ G102), C45 (= C104), G46 (= G105), C48 (= C107), C60 (= C119), C99 (= C158), G100 (= G159), C102 (= C161), C134 (= C208), C136 (= C210)
- binding (molybdopterin-cytosine dinucleotide-s,s)-dioxo-aqua-molybdenum(v): Q98 (= Q157), C136 (= C210)
4usaA Aldehyde oxidoreductase from desulfovibrio gigas (mop), soaked with trans-cinnamaldehyde (see paper)
41% identity, 71% coverage: 65:227/229 of query aligns to 6:156/907 of 4usaA
- binding fe2/s2 (inorganic) cluster: V38 (≠ K97), C40 (= C99), E41 (≠ D100), G43 (= G102), C45 (= C104), G46 (= G105), C48 (= C107), R58 (≠ N117), C60 (= C119), C100 (= C158), G101 (= G159), C103 (= C161), C137 (= C208), C139 (= C210)
- binding (molybdopterin-cytosine dinucleotide-s,s)-dioxo-aqua-molybdenum(v): Q99 (= Q157), C139 (= C210)
Sites not aligning to the query:
- active site: 390, 425, 501, 505, 533, 869, 870
- binding bicarbonate ion: 460, 531, 532, 535, 539
- binding hydrocinnamic acid: 255, 425, 494, 497, 535, 626
- binding magnesium ion: 899, 903
- binding (molybdopterin-cytosine dinucleotide-s,s)-dioxo-aqua-molybdenum(v): 420, 421, 422, 533, 650, 653, 654, 655, 656, 695, 696, 697, 700, 701, 799, 800, 804, 807, 865, 866, 867, 868, 869
4us9A Aldehyde oxidoreductase from desulfovibrio gigas (mop), soaked with 3- phenylpropionaldehyde (see paper)
41% identity, 71% coverage: 65:227/229 of query aligns to 6:156/907 of 4us9A
- binding fe2/s2 (inorganic) cluster: V38 (≠ K97), C40 (= C99), E41 (≠ D100), G43 (= G102), C45 (= C104), G46 (= G105), C48 (= C107), R58 (≠ N117), C60 (= C119), C100 (= C158), G101 (= G159), C103 (= C161), C137 (= C208), C139 (= C210)
- binding (molybdopterin-cytosine dinucleotide-s,s)-dioxo-aqua-molybdenum(v): Q99 (= Q157), C139 (= C210)
Sites not aligning to the query:
- active site: 390, 425, 501, 505, 533, 869, 870
- binding 3-phenylpropanal: 255, 257, 258, 752
- binding bicarbonate ion: 460, 498, 531, 532, 535, 539, 890, 892
- binding magnesium ion: 899, 903
- binding (molybdopterin-cytosine dinucleotide-s,s)-dioxo-aqua-molybdenum(v): 420, 421, 422, 533, 650, 653, 654, 655, 656, 695, 696, 697, 700, 701, 799, 800, 804, 807, 865, 866, 867, 868, 869
4us8A Aldehyde oxidoreductase from desulfovibrio gigas (mop), soaked with benzaldehyde (see paper)
41% identity, 71% coverage: 65:227/229 of query aligns to 6:156/907 of 4us8A
- binding fe2/s2 (inorganic) cluster: V38 (≠ K97), C40 (= C99), E41 (≠ D100), G43 (= G102), C45 (= C104), G46 (= G105), C48 (= C107), R58 (≠ N117), C60 (= C119), C100 (= C158), G101 (= G159), C103 (= C161), C137 (= C208), C139 (= C210)
- binding (molybdopterin-cytosine dinucleotide-s,s)-dioxo-aqua-molybdenum(v): Q99 (= Q157), C139 (= C210)
Sites not aligning to the query:
- active site: 390, 425, 501, 505, 533, 869, 870
- binding bicarbonate ion: 460, 498, 531, 532, 535, 539
- binding benzaldehyde: 255, 255, 394, 425, 425, 425, 425, 497, 497, 501, 531, 535, 535, 626, 626, 626, 694, 696, 697
- binding (molybdopterin-cytosine dinucleotide-s,s)-dioxo-aqua-molybdenum(v): 420, 421, 422, 533, 653, 654, 655, 656, 695, 696, 697, 700, 701, 799, 800, 804, 807, 865, 866, 867, 868, 869
4c7yA Aldehyde oxidoreductase from desulfovibrio gigas (mop), soaked with sodium dithionite and sodium sulfide (see paper)
41% identity, 71% coverage: 65:227/229 of query aligns to 6:156/907 of 4c7yA
- binding fe2/s2 (inorganic) cluster: C40 (= C99), E41 (≠ D100), G43 (= G102), C45 (= C104), G46 (= G105), C48 (= C107), R58 (≠ N117), C60 (= C119), C100 (= C158), G101 (= G159), C103 (= C161), C137 (= C208), C139 (= C210)
- binding (molybdopterin-cytosine dinucleotide-s,s)-dioxo-aqua-molybdenum(v): Q99 (= Q157), C139 (= C210)
Sites not aligning to the query:
- active site: 390, 425, 501, 505, 533, 869, 870
- binding bicarbonate ion: 460, 498, 531, 535, 539
- binding magnesium ion: 899, 903
- binding (molybdopterin-cytosine dinucleotide-s,s)-dioxo-aqua-molybdenum(v): 420, 421, 422, 533, 650, 653, 654, 655, 656, 695, 696, 700, 701, 799, 800, 804, 807, 865, 866, 867, 868, 869
- binding hydrogen peroxide: 696, 697, 869
3fc4A Ethylene glycol inhibited form of aldehyde oxidoreductase from desulfovibrio gigas (see paper)
41% identity, 71% coverage: 65:227/229 of query aligns to 6:156/907 of 3fc4A
- binding fe2/s2 (inorganic) cluster: V38 (≠ K97), C40 (= C99), E41 (≠ D100), G43 (= G102), C45 (= C104), G46 (= G105), C48 (= C107), R58 (≠ N117), C60 (= C119), C100 (= C158), G101 (= G159), C103 (= C161), C137 (= C208), C139 (= C210)
- binding (molybdopterin-cytosine dinucleotide-s,s)-dioxo-aqua-molybdenum(v): Q99 (= Q157), C139 (= C210)
Sites not aligning to the query:
- active site: 390, 425, 501, 505, 533, 869, 870
- binding 1,2-ethanediol: 535, 622, 696, 697, 869
- binding magnesium ion: 899, 903
- binding (molybdopterin-cytosine dinucleotide-s,s)-dioxo-aqua-molybdenum(v): 419, 420, 421, 422, 533, 650, 653, 654, 655, 656, 695, 696, 700, 701, 799, 800, 804, 807, 865, 866, 867, 868, 869
3fahA Glycerol inhibited form of aldehyde oxidoreductase from desulfovibrio gigas (see paper)
41% identity, 71% coverage: 65:227/229 of query aligns to 6:156/907 of 3fahA
- binding fe2/s2 (inorganic) cluster: V38 (≠ K97), C40 (= C99), E41 (≠ D100), G43 (= G102), C45 (= C104), G46 (= G105), C48 (= C107), R58 (≠ N117), C60 (= C119), C100 (= C158), G101 (= G159), C103 (= C161), C137 (= C208), C139 (= C210)
- binding (molybdopterin-cytosine dinucleotide-s,s)-dioxo-aqua-molybdenum(v): Q99 (= Q157), C139 (= C210)
Sites not aligning to the query:
- active site: 390, 425, 501, 505, 533, 869, 870
- binding glycerol: 416, 535, 622, 683, 696, 697, 869, 884, 889, 890, 892
- binding magnesium ion: 899, 903
- binding (molybdopterin-cytosine dinucleotide-s,s)-dioxo-aqua-molybdenum(v): 419, 420, 421, 422, 533, 650, 653, 654, 655, 656, 695, 696, 700, 701, 799, 800, 804, 807, 865, 866, 867, 868, 869
1sijA Crystal structure of the aldehyde dehydrogenase (a.K.A. Aor or mop) of desulfovibrio gigas covalently bound to [aso3]- (see paper)
41% identity, 71% coverage: 65:227/229 of query aligns to 6:156/907 of 1sijA
- binding fe2/s2 (inorganic) cluster: V38 (≠ K97), C40 (= C99), E41 (≠ D100), G43 (= G102), C45 (= C104), G46 (= G105), C48 (= C107), R58 (≠ N117), C60 (= C119), Q99 (= Q157), C100 (= C158), G101 (= G159), C103 (= C161), C137 (= C208), C139 (= C210)
- binding (molybdopterin-cytosine dinucleotide-s,s)-dioxo-aqua-molybdenum(v): Q99 (= Q157), C139 (= C210)
Sites not aligning to the query:
- active site: 390, 425, 501, 505, 533, 869, 870
- binding arsenite: 535, 696, 697, 869
- binding magnesium ion: 899, 903
- binding (molybdopterin-cytosine dinucleotide-s,s)-dioxo-aqua-molybdenum(v): 420, 421, 422, 533, 653, 654, 655, 656, 695, 696, 698, 700, 701, 799, 800, 804, 807, 865, 866, 867, 868, 869
Q46509 Aldehyde oxidoreductase; Molybdenum iron sulfur protein; EC 1.2.99.7 from Megalodesulfovibrio gigas (Desulfovibrio gigas) (see paper)
41% identity, 71% coverage: 65:227/229 of query aligns to 6:156/907 of Q46509
- C40 (= C99) binding
- C45 (= C104) binding
- C48 (= C107) binding
- C60 (= C119) binding
- C100 (= C158) binding
- C103 (= C161) binding
- C137 (= C208) binding
- C139 (= C210) binding
7dqxC Crystal structure of xanthine dehydrogenase family protein
42% identity, 71% coverage: 61:223/229 of query aligns to 4:152/160 of 7dqxC
- binding fe2/s2 (inorganic) cluster: C42 (= C99), G45 (= G102), V46 (≠ Q103), C47 (= C104), C50 (= C107), R60 (≠ N117), C62 (= C119), Q100 (= Q157), C101 (= C158), C104 (= C161), C137 (= C208), C139 (= C210)
- binding pterin cytosine dinucleotide: Q100 (= Q157), C139 (= C210)
1dgjA Crystal structure of the aldehyde oxidoreductase from desulfovibrio desulfuricans atcc 27774 (see paper)
39% identity, 72% coverage: 64:228/229 of query aligns to 5:157/906 of 1dgjA
- binding fe2/s2 (inorganic) cluster: V38 (≠ K97), G39 (= G98), C40 (= C99), G41 (≠ D100), G43 (= G102), Q44 (= Q103), C45 (= C104), G46 (= G105), C48 (= C107), R58 (≠ N117), C60 (= C119), C100 (= C158), G101 (= G159), C103 (= C161), C137 (= C208), C139 (= C210)
- binding pterin cytosine dinucleotide: Q99 (= Q157), C139 (= C210)
Sites not aligning to the query:
- active site: 391, 427, 503, 507, 535, 869, 870
- binding molybdenum (iv)oxide: 424, 535, 698, 869
- binding pterin cytosine dinucleotide: 423, 424, 535, 652, 655, 656, 657, 658, 697, 698, 700, 702, 703, 799, 800, 803, 804, 807, 865, 866, 867, 868, 869
1sb3C Structure of 4-hydroxybenzoyl-coa reductase from thauera aromatica (see paper)
41% identity, 71% coverage: 63:224/229 of query aligns to 5:151/161 of 1sb3C
- binding fe2/s2 (inorganic) cluster: Q39 (≠ K97), C41 (= C99), G44 (= G102), C46 (= C104), G47 (= G105), C49 (= C107), C61 (= C119), C100 (= C158), G101 (= G159), C103 (= C161), C135 (= C208), C137 (= C210)
- binding (molybdopterin-cytosine dinucleotide-s,s)-dioxo-aqua-molybdenum(v): Q99 (= Q157), C137 (= C210)
P19921 Carbon monoxide dehydrogenase small chain; CO dehydrogenase subunit S; CO-DH S; EC 1.2.5.3 from Afipia carboxidovorans (strain ATCC 49405 / DSM 1227 / KCTC 32145 / OM5) (Oligotropha carboxidovorans) (see 2 papers)
40% identity, 72% coverage: 63:228/229 of query aligns to 6:157/166 of P19921
- C42 (= C99) binding
- C47 (= C104) binding
- C50 (= C107) binding
- C62 (= C119) binding
- C102 (= C158) binding
- C105 (= C161) binding
- C137 (= C208) binding
- C139 (= C210) binding
1n5wA Crystal structure of the cu,mo-co dehydrogenase (codh); oxidized form (see paper)
40% identity, 72% coverage: 63:228/229 of query aligns to 4:155/161 of 1n5wA
- binding flavin-adenine dinucleotide: S43 (≠ G102), H44 (≠ Q103)
- binding fe2/s2 (inorganic) cluster: I38 (≠ K97), G39 (= G98), C40 (= C99), S43 (≠ G102), C45 (= C104), G46 (= G105), C48 (= C107), C60 (= C119), C100 (= C158), G101 (= G159), C103 (= C161), C135 (= C208), C137 (= C210)
Query Sequence
>14424 FitnessBrowser__Keio:14424
MSNQGEYPEDNRVGKHEPHDLSLTRRDLIKVSAATAATAVVYPHSTLAASVPAATPAPEI
MPLTLKVNGKTEQLEVDTRTTLLDTLRENLHLIGTKKGCDHGQCGACTVLVNGRRLNACL
TLAVMHQGAEITTIEGLGSPDNLHPMQAAFIKHDGFQCGYCTSGQICSSVAVLKEIQDGI
PSHVTVDLVSAPETTADEIRERMSGNICRCGAYANILAAIEDAAGEIKS
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory