Comparing 14480 FitnessBrowser__Keio:14480 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
P07464 Galactoside O-acetyltransferase; GAT; Acetyl-CoA:galactoside 6-O-acetyltransferase; Thiogalactoside acetyltransferase; Thiogalactoside transacetylase; EC 2.3.1.18 from Escherichia coli (strain K12) (see 3 papers)
100% identity, 100% coverage: 1:203/203 of query aligns to 1:203/203 of P07464
1krvA Galactoside acetyltransferase in complex with coa and pnp-beta-gal (see paper)
100% identity, 99% coverage: 2:202/203 of query aligns to 1:201/201 of 1krvA
1kruA Galactoside acetyltransferase in complex with iptg and coenzyme a (see paper)
100% identity, 99% coverage: 2:202/203 of query aligns to 1:201/201 of 1kruA
1krrA Galactoside acetyltransferase in complex with acetyl-coenzyme a (see paper)
100% identity, 99% coverage: 2:201/203 of query aligns to 1:200/200 of 1krrA
4isxA The crystal structure of maltose o-acetyltransferase from clostridium difficile 630 in complex with acetyl-coa
47% identity, 91% coverage: 3:187/203 of query aligns to 2:186/186 of 4isxA
5u2kA Crystal structure of galactoside o-acetyltransferase complex with coa (h3 space group)
42% identity, 91% coverage: 3:187/203 of query aligns to 1:186/190 of 5u2kA
3igjC Crystal structure of maltose o-acetyltransferase complexed with acetyl coenzyme a from bacillus anthracis
40% identity, 89% coverage: 7:187/203 of query aligns to 7:188/188 of 3igjC
3nz2C Crystal structure of hexapeptide-repeat containing-acetyltransferase vca0836 complexed with acetyl co enzyme a from vibrio cholerae o1 biovar eltor
35% identity, 91% coverage: 3:187/203 of query aligns to 1:183/183 of 3nz2C
3nz2J Crystal structure of hexapeptide-repeat containing-acetyltransferase vca0836 complexed with acetyl co enzyme a from vibrio cholerae o1 biovar eltor
34% identity, 92% coverage: 1:186/203 of query aligns to 2:185/185 of 3nz2J
3ectA Crystal structure of the hexapeptide-repeat containing- acetyltransferase vca0836 from vibrio cholerae
37% identity, 80% coverage: 26:187/203 of query aligns to 17:176/176 of 3ectA
A1ADJ6 Polysialic acid O-acetyltransferase; Capsule O-acetyl transferase; EC 2.3.1.136 from Escherichia coli O1:K1 / APEC (see paper)
37% identity, 64% coverage: 55:184/203 of query aligns to 148:279/307 of A1ADJ6
1mrlA Crystal structure of streptogramin a acetyltransferase with dalfopristin (see paper)
36% identity, 51% coverage: 96:198/203 of query aligns to 61:180/204 of 1mrlA
Sites not aligning to the query:
3dhoA Structure of streptogramin acetyltransferase in complex with an inhibitor
36% identity, 51% coverage: 96:198/203 of query aligns to 61:180/203 of 3dhoA
1kk4A Crystal structure of vat(d) in complex with acetyl-coa (see paper)
36% identity, 51% coverage: 96:198/203 of query aligns to 61:180/205 of 1kk4A
P50870 Streptogramin A acetyltransferase; Virginiamycin acetyltransferase D; Vat(D); EC 2.3.1.- from Enterococcus faecium (Streptococcus faecium) (see paper)
36% identity, 51% coverage: 96:198/203 of query aligns to 61:180/209 of P50870
1khrA Crystal structure of vat(d) in complex with virginiamycin and coenzyme a (see paper)
36% identity, 51% coverage: 96:198/203 of query aligns to 61:180/206 of 1khrA
Sites not aligning to the query:
7s45A Crystal structure of an n-acetyltransferase, c80t mutant, from helicobacter pullorum in the presence of acetyl coenzyme a and dtdp (see paper)
34% identity, 58% coverage: 56:172/203 of query aligns to 31:135/141 of 7s45A
7uukC Crystal structure of aminoglycoside resistance enzyme apma, complex with tobramycin (see paper)
45% identity, 26% coverage: 131:183/203 of query aligns to 178:232/276 of 7uukC
Sites not aligning to the query:
7uumA Crystal structure of aminoglycoside resistance enzyme apma, complex with paromomycin and coenzyme a (see paper)
45% identity, 26% coverage: 131:183/203 of query aligns to 178:232/274 of 7uumA
Sites not aligning to the query:
7uulA Crystal structure of aminoglycoside resistance enzyme apma, complex with kanamycin b and coenzyme a (see paper)
45% identity, 26% coverage: 131:183/203 of query aligns to 177:231/274 of 7uulA
Sites not aligning to the query:
>14480 FitnessBrowser__Keio:14480
MNMPMTERIRAGKLFTDMCEGLPEKRLRGKTLMYEFNHSHPSEVEKRESLIKEMFATVGE
NAWVEPPVYFSYGSNIHIGRNFYANFNLTIVDDYTVTIGDNVLIAPNVTLSVTGHPVHHE
LRKNGEMYSFPITIGNNVWIGSHVVINPGVTIGDNSVIGAGSIVTKDIPPNVVAAGVPCR
VIREINDRDKHYYFKDYKVESSV
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory