SitesBLAST
Comparing 14482 FitnessBrowser__Keio:14482 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
P00722 Beta-galactosidase; Beta-gal; Lactase; EC 3.2.1.23 from Escherichia coli (strain K12) (see 13 papers)
100% identity, 100% coverage: 1:1024/1024 of query aligns to 1:1024/1024 of P00722
- M1 (= M1) modified: Initiator methionine, Removed
- D202 (= D202) mutation D->E,N: Causes a significant decrease in binding affinity in the absence of monovalent cations or in the presence of potassium ions, but only a moderate decrease in the presence of sodium ions.; mutation to F: Obliterates all binding and catalysis.
- H358 (= H358) mutation H->D,F,L,N: Less stable to heat than wild-type. Causes significant destabilizations of the first transition state.
- H392 (= H392) mutation H->E,F,K: Essentially inactive unless very rapid purification. Causes very large destabilizations of the transition state.
- E417 (= E417) binding
- H419 (= H419) binding
- E462 (= E462) active site, Proton donor; binding ; mutation to H: Slowly inactivates galactosidase activity by reducing the binding of magnesium. It increases binding specificity.
- E538 (= E538) active site, Nucleophile; mutation to Q: 10000-fold decrease in the beta-galactosidase activity.
- H541 (= H541) mutation H->E,F,N: Poorly reactive with galactosyl substrates. Less stable to heat than wild-type.
- N598 (= N598) binding
- F602 (= F602) mutation to A: Decreases the stability of the loop 794-804.
- G795 (= G795) mutation to A: It forces the apoenzyme to adopt the closed rather than the open conformation. Reduces the binding affinity.
- E798 (= E798) mutation E->A,L: The catalytic efficiency is not increased, when the sodium concentration increases.; mutation E->D,Q: Small increase of the catalytic efficiency, when the sodium concentration increases.
- W1000 (= W1000) mutation W->F,G,L,T: Decreases affinity for substrate.
5a1aA 2.2 a resolution cryo-em structure of beta-galactosidase in complex with a cell-permeant inhibitor (see paper)
100% identity, 100% coverage: 3:1024/1024 of query aligns to 1:1022/1022 of 5a1aA
- active site: D200 (= D202), H356 (= H358), H390 (= H392), E415 (= E417), H417 (= H419), E460 (= E462), Y502 (= Y504), E536 (= E538), N596 (= N598), F600 (= F602), N603 (= N605)
- binding magnesium ion: D14 (= D16), W15 (= W17), N17 (= N19), V20 (= V22), Q162 (= Q164), D192 (= D194), E415 (= E417), H417 (= H419), E460 (= E462)
- binding sodium ion: D200 (= D202), H539 (= H541), F555 (= F557), Y558 (= Y560), P559 (= P561), L561 (= L563), F600 (= F602), N603 (= N605)
- binding 2-phenylethyl 1-thio-beta-D-galactopyranoside: N101 (= N103), D200 (= D202), M501 (= M503), Y502 (= Y504), H539 (= H541), D597 (= D599), F600 (= F602), W998 (= W1000)
7btkC E.Coli beta-galactosidase (e537q) in complex with fluorescent probe ksa01 (see paper)
100% identity, 100% coverage: 2:1024/1024 of query aligns to 1:1023/1023 of 7btkC
- binding 4-[[2-[(E)-2-[4-[(2S,3R,4S,5R,6R)-6-(hydroxymethyl)-3,4,5-tris(oxidanyl)oxan-2-yl]oxyphenyl]ethenyl]-3,3-dimethyl-2H-indol-1-yl]methyl]benzoic acid: N102 (= N103), D201 (= D202), H391 (= H392), N460 (= N461), E461 (= E462), Y503 (= Y504), F512 (= F513), Q537 (≠ E538), W568 (= W569), W999 (= W1000)
- binding magnesium ion: D15 (= D16), N18 (= N19), V21 (= V22), Q163 (= Q164), D193 (= D194), D201 (= D202), E416 (= E417), H418 (= H419), E461 (= E462)
7brsA E.Coli beta-galactosidase (e537q) in complex with fluorescent probe ksa02 (see paper)
100% identity, 100% coverage: 4:1024/1024 of query aligns to 1:1021/1021 of 7brsA
- binding 8-[2-[(E)-2-[4-[(2S,3R,4S,5R,6R)-6-(hydroxymethyl)-3,4,5-tris(oxidanyl)oxan-2-yl]oxyphenyl]ethenyl]-3,3-dimethyl-indol-1-ium-1-yl]octanoic acid: N100 (= N103), D199 (= D202), E459 (= E462), Y501 (= Y504), Q535 (≠ E538), H538 (= H541), N602 (= N605), W997 (= W1000)
- binding magnesium ion: D13 (= D16), N16 (= N19), V19 (= V22), Q161 (= Q164), D191 (= D194), E414 (= E417), H416 (= H419), E459 (= E462)
6kuzA E.Coli beta-galactosidase (e537q) in complex with fluorescent probe ksl01 (see paper)
100% identity, 100% coverage: 4:1024/1024 of query aligns to 1:1021/1021 of 6kuzA
- binding 3-(1,3-benzothiazol-2-yl)-2-[[4-[(2~{S},3~{R},4~{S},5~{R},6~{R})-6-(hydroxymethyl)-3,4,5-tris(oxidanyl)oxan-2-yl]oxyphenyl]methoxy]-5-methyl-benzaldehyde: N100 (= N103), D199 (= D202), H389 (= H392), H416 (= H419), E459 (= E462), Y501 (= Y504), Q535 (≠ E538), H538 (= H541), W566 (= W569), W997 (= W1000)
- binding magnesium ion: D13 (= D16), N16 (= N19), V19 (= V22), Q161 (= Q164), D191 (= D194), E414 (= E417), H416 (= H419), E459 (= E462)
6tshA Beta-galactosidase in complex with deoxygalacto-nojirimycin (see paper)
100% identity, 99% coverage: 10:1024/1024 of query aligns to 1:1015/1015 of 6tshA
- binding (2R,3S,4R,5S)-2-(hydroxymethyl)piperidine-3,4,5-triol: D193 (= D202), H383 (= H392), E453 (= E462), E529 (= E538), H532 (= H541), W560 (= W569), F593 (= F602)
- binding magnesium ion: E408 (= E417), H410 (= H419), E453 (= E462)
4duxA E. Coli (lacz) beta-galactosidase (n460s) in complex with l-ribose (see paper)
100% identity, 99% coverage: 10:1024/1024 of query aligns to 1:1015/1015 of 4duxA
- active site: D193 (= D202), H349 (= H358), H383 (= H392), E408 (= E417), H410 (= H419), E453 (= E462), Y495 (= Y504), E529 (= E538), N589 (= N598), F593 (= F602), N596 (= N605)
- binding beta-L-ribopyranose: D193 (= D202), H383 (= H392), E453 (= E462), M494 (= M503), Y495 (= Y504), E529 (= E538), H532 (= H541), W560 (= W569), F593 (= F602), S788 (= S797), W991 (= W1000)
- binding magnesium ion: D7 (= D16), N10 (= N19), V13 (= V22), Q155 (= Q164), D185 (= D194), E408 (= E417), H410 (= H419), E453 (= E462)
1jz6A E. Coli (lacz) beta-galactosidase in complex with galacto-tetrazole (see paper)
100% identity, 99% coverage: 14:1024/1024 of query aligns to 1:1011/1011 of 1jz6A
- active site: D189 (= D202), H345 (= H358), H379 (= H392), E404 (= E417), H406 (= H419), E449 (= E462), Y491 (= Y504), E525 (= E538), N585 (= N598), F589 (= F602), N592 (= N605)
- binding (5r, 6s, 7s, 8s)-5-hydroxymethyl-6,7,8-trihydroxy-tetrazolo[1,5-a]piperidine: D189 (= D202), H379 (= H392), E449 (= E462), Y491 (= Y504), E525 (= E538), H528 (= H541), W556 (= W569), N592 (= N605)
- binding magnesium ion: D3 (= D16), N6 (= N19), V9 (= V22), Q151 (= Q164), D181 (= D194), E404 (= E417), H406 (= H419), E449 (= E462), S635 (= S648), E638 (= E651), L658 (= L671)
- binding sodium ion: D189 (= D202), F544 (= F557), Y547 (= Y560), P548 (= P561), L550 (= L563), F589 (= F602), C590 (= C603), N592 (= N605), F919 (= F932), P920 (= P933), L955 (= L968), M956 (= M969), T958 (= T971)
1jz5A E. Coli (lacz) beta-galactosidase in complex with d-galctopyranosyl-1- on (see paper)
100% identity, 99% coverage: 14:1024/1024 of query aligns to 1:1011/1011 of 1jz5A
- active site: D189 (= D202), H345 (= H358), H379 (= H392), E404 (= E417), H406 (= H419), E449 (= E462), Y491 (= Y504), E525 (= E538), N585 (= N598), F589 (= F602), N592 (= N605)
- binding D-galactonolactone: D189 (= D202), H379 (= H392), N448 (= N461), E449 (= E462), M490 (= M503), Y491 (= Y504), E525 (= E538), H528 (= H541), W556 (= W569), F589 (= F602), N592 (= N605)
- binding magnesium ion: D3 (= D16), N6 (= N19), V9 (= V22), Q151 (= Q164), D181 (= D194), E404 (= E417), H406 (= H419), E449 (= E462)
1jz3A E. Coli (lacz) beta-galactosidase-trapped 2-deoxy-galactosyl enzyme intermediate (see paper)
100% identity, 99% coverage: 14:1024/1024 of query aligns to 1:1011/1011 of 1jz3A
- active site: D189 (= D202), H345 (= H358), H379 (= H392), E404 (= E417), H406 (= H419), E449 (= E462), Y491 (= Y504), E525 (= E538), N585 (= N598), F589 (= F602), N592 (= N605)
- binding 2-deoxy-alpha-D-galactopyranose: D189 (= D202), H379 (= H392), E449 (= E462), Y491 (= Y504), E525 (= E538), H528 (= H541), W556 (= W569), F589 (= F602)
- binding magnesium ion: D3 (= D16), N6 (= N19), V9 (= V22), Q151 (= Q164), D181 (= D194), E404 (= E417), H406 (= H419), E449 (= E462)
1jz2A E. Coli (lacz) beta-galactosidase-trapped 2-f-galactosyl-enzyme intermediate (orthorhombic) (see paper)
100% identity, 99% coverage: 14:1024/1024 of query aligns to 1:1011/1011 of 1jz2A
- active site: D189 (= D202), H345 (= H358), H379 (= H392), E404 (= E417), H406 (= H419), E449 (= E462), Y491 (= Y504), E525 (= E538), N585 (= N598), F589 (= F602), N592 (= N605)
- binding 2-deoxy-2-fluoro-beta-D-galactopyranose: D189 (= D202), H379 (= H392), N448 (= N461), E449 (= E462), Y491 (= Y504), E525 (= E538), H528 (= H541), W556 (= W569), F589 (= F602)
- binding magnesium ion: D3 (= D16), N6 (= N19), V9 (= V22), Q151 (= Q164), D181 (= D194), E404 (= E417), H406 (= H419), E449 (= E462)
- binding sodium ion: D189 (= D202), F544 (= F557), Y547 (= Y560), P548 (= P561), L550 (= L563), Q551 (= Q564), F589 (= F602), N592 (= N605), F919 (= F932), P920 (= P933), L955 (= L968), M956 (= M969), T958 (= T971)
1jyxA E. Coli (lacz) beta-galactosidase in complex with iptg (see paper)
100% identity, 99% coverage: 14:1024/1024 of query aligns to 1:1011/1011 of 1jyxA
- active site: D189 (= D202), H345 (= H358), H379 (= H392), E404 (= E417), H406 (= H419), E449 (= E462), Y491 (= Y504), E525 (= E538), N585 (= N598), F589 (= F602), N592 (= N605)
- binding 1-methylethyl 1-thio-beta-D-galactopyranoside: N90 (= N103), D189 (= D202), E292 (= E305), P294 (= P307), E449 (= E462), E525 (= E538), H528 (= H541), N592 (= N605), R633 (= R646), D636 (= D649), Q690 (= Q703), W696 (= W709), W987 (= W1000)
- binding magnesium ion: D3 (= D16), N6 (= N19), V9 (= V22), Q151 (= Q164), D181 (= D194), E404 (= E417), H406 (= H419), E449 (= E462)
- binding sodium ion: D189 (= D202), F544 (= F557), Y547 (= Y560), P548 (= P561), L550 (= L563), Q551 (= Q564), F589 (= F602), C590 (= C603), N592 (= N605), F919 (= F932), P920 (= P933), L955 (= L968), M956 (= M969), T958 (= T971)
1jywA E. Coli (lacz) beta-galactosidase (e537q) in complex with pnpg (see paper)
100% identity, 99% coverage: 14:1024/1024 of query aligns to 1:1011/1011 of 1jywA
- active site: D189 (= D202), H345 (= H358), H379 (= H392), E404 (= E417), H406 (= H419), E449 (= E462), Y491 (= Y504), Q525 (≠ E538), N585 (= N598), F589 (= F602), N592 (= N605)
- binding 4-nitrophenyl beta-D-galactopyranoside: N90 (= N103), D189 (= D202), E449 (= E462), Y491 (= Y504), Q525 (≠ E538), H528 (= H541), N592 (= N605), W987 (= W1000)
- binding magnesium ion: D3 (= D16), N6 (= N19), V9 (= V22), Q151 (= Q164), D181 (= D194), E404 (= E417), H406 (= H419), E449 (= E462)
1jyvA E. Coli (lacz) beta-galactosidase (e537q) in complex with onpg (see paper)
100% identity, 99% coverage: 14:1024/1024 of query aligns to 1:1011/1011 of 1jyvA
- active site: D189 (= D202), H345 (= H358), H379 (= H392), E404 (= E417), H406 (= H419), E449 (= E462), Y491 (= Y504), Q525 (≠ E538), N585 (= N598), F589 (= F602), N592 (= N605)
- binding 2-nitrophenyl beta-D-galactopyranoside: N90 (= N103), N90 (= N103), V91 (= V104), D189 (= D202), H406 (= H419), E449 (= E462), Y491 (= Y504), H528 (= H541), D586 (= D599), F589 (= F602), N592 (= N605), V783 (= V796), V783 (= V796), E785 (= E798), R788 (= R801), W987 (= W1000)
- binding magnesium ion: D3 (= D16), N6 (= N19), V9 (= V22), Q151 (= Q164), D181 (= D194), E404 (= E417), H406 (= H419), E449 (= E462)
1jynA E. Coli (lacz) beta-galactosidase (e537q) in complex with lactose (see paper)
100% identity, 99% coverage: 14:1024/1024 of query aligns to 1:1011/1011 of 1jynA
- active site: D189 (= D202), H345 (= H358), H379 (= H392), E404 (= E417), H406 (= H419), E449 (= E462), Y491 (= Y504), Q525 (≠ E538), N585 (= N598), F589 (= F602), N592 (= N605)
- binding beta-D-glucopyranose: N90 (= N103), W987 (= W1000)
- binding beta-D-galactopyranose: N90 (= N103), D189 (= D202), E449 (= E462), Y491 (= Y504), H528 (= H541), N592 (= N605), W987 (= W1000)
- binding magnesium ion: D3 (= D16), N6 (= N19), V9 (= V22), Q151 (= Q164), D181 (= D194), E404 (= E417), H406 (= H419), E449 (= E462)
- binding sodium ion: D189 (= D202), F544 (= F557), Y547 (= Y560), P548 (= P561), L550 (= L563), F589 (= F602), N592 (= N605), S635 (= S648), D636 (= D649), E638 (= E651), L658 (= L671), F919 (= F932), P920 (= P933), L955 (= L968), M956 (= M969), T958 (= T971)
6s6zA Structure of beta-galactosidase from thermotoga maritima (see paper)
36% identity, 98% coverage: 16:1019/1024 of query aligns to 3:977/1083 of 6s6zA
P06864 Evolved beta-galactosidase subunit alpha; Beta-gal; Lactase; EC 3.2.1.23 from Escherichia coli (strain K12) (see paper)
34% identity, 96% coverage: 17:1004/1024 of query aligns to 4:980/1030 of P06864
- E449 (= E462) active site, Proton donor
3bgaA Crystal structure of beta-galactosidase from bacteroides thetaiotaomicron vpi-5482
34% identity, 96% coverage: 16:995/1024 of query aligns to 3:967/1003 of 3bgaA
- active site: D201 (= D202), H354 (= H358), H387 (= H392), E412 (= E417), H414 (= H419), E458 (= E462), Y499 (= Y504), E522 (= E538), S584 (≠ N598), F588 (= F602), N591 (= N605)
- binding magnesium ion: E412 (= E417), H414 (= H419), E458 (= E462)
6secA Cold-adapted beta-d-galactosidase from arthrobacter sp. 32cbon complex with onpg (see paper)
35% identity, 96% coverage: 34:1011/1024 of query aligns to 17:975/988 of 6secA
6sebA Cold-adapted beta-d-galactosidase from arthrobacter sp. 32cb in complex with iptg (see paper)
35% identity, 96% coverage: 34:1011/1024 of query aligns to 17:975/989 of 6sebA
- binding 1-methylethyl 1-thio-beta-D-galactopyranoside: D186 (= D202), E420 (= E462), Y461 (= Y504), E496 (= E538), H499 (= H541), D887 (≠ Y927), R939 (= R974), L942 (= L977), K943 (≠ H978), A944 (= A979), C964 (≠ W1000)
Query Sequence
>14482 FitnessBrowser__Keio:14482
MTMITDSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWR
FAWFPAPEAVPESWLECDLPEADTVVVPSNWQMHGYDAPIYTNVTYPITVNPPFVPTENP
TGCYSLTFNVDESWLQEGQTRIIFDGVNSAFHLWCNGRWVGYGQDSRLPSEFDLSAFLRA
GENRLAVMVLRWSDGSYLEDQDMWRMSGIFRDVSLLHKPTTQISDFHVATRFNDDFSRAV
LEAEVQMCGELRDYLRVTVSLWQGETQVASGTAPFGGEIIDERGGYADRVTLRLNVENPK
LWSAEIPNLYRAVVELHTADGTLIEAEACDVGFREVRIENGLLLLNGKPLLIRGVNRHEH
HPLHGQVMDEQTMVQDILLMKQNNFNAVRCSHYPNHPLWYTLCDRYGLYVVDEANIETHG
MVPMNRLTDDPRWLPAMSERVTRMVQRDRNHPSVIIWSLGNESGHGANHDALYRWIKSVD
PSRPVQYEGGGADTTATDIICPMYARVDEDQPFPAVPKWSIKKWLSLPGETRPLILCEYA
HAMGNSLGGFAKYWQAFRQYPRLQGGFVWDWVDQSLIKYDENGNPWSAYGGDFGDTPNDR
QFCMNGLVFADRTPHPALTEAKHQQQFFQFRLSGQTIEVTSEYLFRHSDNELLHWMVALD
GKPLASGEVPLDVAPQGKQLIELPELPQPESAGQLWLTVRVVQPNATAWSEAGHISAWQQ
WRLAENLSVTLPAASHAIPHLTTSEMDFCIELGNKRWQFNRQSGFLSQMWIGDKKQLLTP
LRDQFTRAPLDNDIGVSEATRIDPNAWVERWKAAGHYQAEAALLQCTADTLADAVLITTA
HAWQHQGKTLFISRKTYRIDGSGQMAITVDVEVASDTPHPARIGLNCQLAQVAERVNWLG
LGPQENYPDRLTAACFDRWDLPLSDMYTPYVFPSENGLRCGTRELNYGPHQWRGDFQFNI
SRYSQQQLMETSHRHLLHAEEGTWLNIDGFHMGIGGDDSWSPSVSAEFQLSAGRYHYQLV
WCQK
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory