Comparing 14596 FitnessBrowser__Keio:14596 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
3igjC Crystal structure of maltose o-acetyltransferase complexed with acetyl coenzyme a from bacillus anthracis
63% identity, 100% coverage: 1:183/183 of query aligns to 2:186/188 of 3igjC
4isxA The crystal structure of maltose o-acetyltransferase from clostridium difficile 630 in complex with acetyl-coa
57% identity, 99% coverage: 3:183/183 of query aligns to 3:184/186 of 4isxA
1krvA Galactoside acetyltransferase in complex with coa and pnp-beta-gal (see paper)
44% identity, 97% coverage: 6:183/183 of query aligns to 6:184/201 of 1krvA
1kruA Galactoside acetyltransferase in complex with iptg and coenzyme a (see paper)
44% identity, 97% coverage: 6:183/183 of query aligns to 6:184/201 of 1kruA
1krrA Galactoside acetyltransferase in complex with acetyl-coenzyme a (see paper)
44% identity, 97% coverage: 6:183/183 of query aligns to 6:184/200 of 1krrA
P07464 Galactoside O-acetyltransferase; GAT; Acetyl-CoA:galactoside 6-O-acetyltransferase; Thiogalactoside acetyltransferase; Thiogalactoside transacetylase; EC 2.3.1.18 from Escherichia coli (strain K12) (see 3 papers)
44% identity, 97% coverage: 6:183/183 of query aligns to 7:185/203 of P07464
Sites not aligning to the query:
5u2kA Crystal structure of galactoside o-acetyltransferase complex with coa (h3 space group)
39% identity, 99% coverage: 3:183/183 of query aligns to 2:184/190 of 5u2kA
3nz2J Crystal structure of hexapeptide-repeat containing-acetyltransferase vca0836 complexed with acetyl co enzyme a from vibrio cholerae o1 biovar eltor
41% identity, 99% coverage: 3:183/183 of query aligns to 5:184/185 of 3nz2J
3nz2C Crystal structure of hexapeptide-repeat containing-acetyltransferase vca0836 complexed with acetyl co enzyme a from vibrio cholerae o1 biovar eltor
41% identity, 99% coverage: 3:183/183 of query aligns to 2:181/183 of 3nz2C
3ectA Crystal structure of the hexapeptide-repeat containing- acetyltransferase vca0836 from vibrio cholerae
40% identity, 97% coverage: 6:183/183 of query aligns to 2:174/176 of 3ectA
A1ADJ6 Polysialic acid O-acetyltransferase; Capsule O-acetyl transferase; EC 2.3.1.136 from Escherichia coli O1:K1 / APEC (see paper)
37% identity, 52% coverage: 87:182/183 of query aligns to 183:279/307 of A1ADJ6
Q93S40 Polysialic acid O-acetyltransferase; Polysialyltransferase; PST; EC 2.3.1.- from Neisseria meningitidis (see paper)
44% identity, 49% coverage: 94:182/183 of query aligns to 101:191/215 of Q93S40
2wlfA Crystallographic analysis of the polysialic acid o- acetyltransferase oatwy (see paper)
44% identity, 49% coverage: 94:182/183 of query aligns to 97:187/210 of 2wlfA
2wlgA Crystallographic analysis of the polysialic acid o- acetyltransferase oatwy (see paper)
44% identity, 49% coverage: 94:182/183 of query aligns to 97:187/211 of 2wlgA
2wleC Crystallographic analysis of the polysialic acid o- acetyltransferase oatwy (see paper)
44% identity, 49% coverage: 94:182/183 of query aligns to 97:187/211 of 2wleC
4mzuB Crystal structure of fdtd, a bifunctional ketoisomerase/n- acetyltransferase from shewanella denitrificans (see paper)
38% identity, 46% coverage: 96:179/183 of query aligns to 49:139/290 of 4mzuB
Sites not aligning to the query:
1mrlA Crystal structure of streptogramin a acetyltransferase with dalfopristin (see paper)
36% identity, 54% coverage: 84:182/183 of query aligns to 46:166/204 of 1mrlA
Sites not aligning to the query:
P50870 Streptogramin A acetyltransferase; Virginiamycin acetyltransferase D; Vat(D); EC 2.3.1.- from Enterococcus faecium (Streptococcus faecium) (see paper)
36% identity, 54% coverage: 84:182/183 of query aligns to 46:166/209 of P50870
1kk4A Crystal structure of vat(d) in complex with acetyl-coa (see paper)
36% identity, 54% coverage: 84:182/183 of query aligns to 46:166/205 of 1kk4A
3dhoA Structure of streptogramin acetyltransferase in complex with an inhibitor
36% identity, 54% coverage: 84:182/183 of query aligns to 46:166/203 of 3dhoA
>14596 FitnessBrowser__Keio:14596
MSTEKEKMIAGELYRSADETLSRDRLRARQLIHRYNHSLAEEHTLRQQILADLFGQVTEA
YIEPTFRCDYGYNIFLGNNFFANFDCVMLDVCPIRIGDNCMLAPGVHIYTATHPIDPVAR
NSGAELGKPVTIGNNVWIGGRAVINPGVTIGDNVVVASGAVVTKDVPDNVVVGGNPARII
KKL
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory