SitesBLAST
Comparing 14724 FitnessBrowser__Keio:14724 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
P07821 Iron(3+)-hydroxamate import ATP-binding protein FhuC; Ferric hydroxamate uptake protein C; Ferrichrome transport ATP-binding protein FhuC; Iron(III)-hydroxamate import ATP-binding protein FhuC; EC 7.2.2.16 from Escherichia coli (strain K12) (see 2 papers)
45% identity, 87% coverage: 21:257/271 of query aligns to 25:261/265 of P07821
- K50 (= K46) mutation to Q: Lack of activity.
- D172 (= D168) mutation to E: Lack of activity.
- E173 (= E169) mutation to A: Lack of activity.
4ymuJ Crystal structure of an amino acid abc transporter complex with arginines and atps (see paper)
32% identity, 80% coverage: 16:231/271 of query aligns to 10:223/240 of 4ymuJ
- binding adenosine-5'-triphosphate: F11 (≠ Y17), V16 (= V22), S36 (≠ N42), G37 (= G43), S38 (≠ C44), G39 (= G45), K40 (= K46), S41 (= S47), T42 (= T48), E162 (= E169), H194 (= H202)
- binding magnesium ion: S41 (= S47), E162 (= E169)
4u00A Crystal structure of ttha1159 in complex with adp (see paper)
35% identity, 82% coverage: 17:239/271 of query aligns to 12:231/241 of 4u00A
7chaI Cryo-em structure of p.Aeruginosa mlafebd with amppnp (see paper)
31% identity, 80% coverage: 13:228/271 of query aligns to 9:224/262 of 7chaI
5x40A Structure of a cbio dimer bound with amppcp (see paper)
35% identity, 83% coverage: 8:233/271 of query aligns to 5:229/280 of 5x40A
- binding phosphomethylphosphonic acid adenylate ester: F14 (≠ Y17), V18 (≠ Y20), A20 (≠ V22), N40 (= N42), G41 (= G43), G43 (= G45), K44 (= K46), S45 (= S47), T46 (= T48), Q88 (= Q88), H139 (≠ D142), M140 (≠ T143), L141 (= L144), S142 (= S145), G144 (= G147), Q145 (= Q148), Q166 (≠ E169), H198 (= H202)
- binding magnesium ion: S45 (= S47), Q88 (= Q88)
P0AAH0 Phosphate import ATP-binding protein PstB; ABC phosphate transporter; Phosphate-transporting ATPase; EC 7.3.2.1 from Escherichia coli (strain K12) (see paper)
31% identity, 84% coverage: 6:233/271 of query aligns to 9:241/257 of P0AAH0
- G48 (= G45) mutation to I: Loss of phosphate transport.
- K49 (= K46) mutation to Q: Loss of phosphate transport.
Sites not aligning to the query:
- 1 modified: Initiator methionine, Removed
P68187 Maltose/maltodextrin import ATP-binding protein MalK; EC 7.5.2.1 from Escherichia coli (strain K12) (see 5 papers)
29% identity, 84% coverage: 5:231/271 of query aligns to 1:221/371 of P68187
- A85 (≠ T91) mutation to M: Suppressor of EAA loop mutations in MalFG.
- K106 (≠ W116) mutation to C: Suppressor of EAA loop mutations in MalFG.
- V114 (= V124) mutation to C: Suppressor of EAA loop mutations in MalFG.
- V117 (≠ A127) mutation to M: Suppressor of EAA loop mutations in MalFG.
- E119 (≠ Q129) mutation to K: Resistant to inhibitory effects of alpha-methylglucoside but retains transport capacity.
- A124 (≠ T134) mutation to T: Resistant to inhibitory effects of alpha-methylglucoside but retains transport capacity.
- G137 (= G147) mutation to A: Loss of maltose transport. Has greater ability to decrease mal gene expression than wild-type MalK.
- D158 (= D168) mutation to N: Loss of maltose transport but retains ability to repress mal genes.
Sites not aligning to the query:
- 228 R→C: Resistant to inhibitory effects of alpha-methylglucoside but retains transport capacity.
- 241 F→I: Resistant to inhibitory effects of alpha-methylglucoside but retains transport capacity.
- 267 W→G: Normal maltose transport but constitutive mal gene expression.
- 278 G→P: Resistant to inhibitory effects of alpha-methylglucoside but retains transport capacity.
- 282 S→L: Resistant to inhibitory effects of alpha-methylglucoside but retains transport capacity.
- 284 G→S: Resistant to inhibitory effects of alpha-methylglucoside but retains transport capacity.
- 302 G→D: Resistant to inhibitory effects of alpha-methylglucoside but retains transport capacity.
- 308 E→Q: Maltose transport is affected but retains ability to interact with MalT.
- 322 S→F: Resistant to inhibitory effects of alpha-methylglucoside but retains transport capacity.
- 340 G→A: Maltose transport is affected but retains ability to interact with MalT.
- 346 G→S: Normal maltose transport but constitutive mal gene expression.
- 355 F→Y: Maltose transport is affected but retains ability to interact with MalT.
2awnB Crystal structure of the adp-mg-bound e. Coli malk (crystallized with atp-mg) (see paper)
29% identity, 83% coverage: 6:231/271 of query aligns to 1:220/374 of 2awnB
3puyA Crystal structure of an outward-facing mbp-maltose transporter complex bound to amp-pnp after crystal soaking of the pretranslocation state (see paper)
29% identity, 83% coverage: 6:231/271 of query aligns to 1:220/371 of 3puyA
- binding phosphoaminophosphonic acid-adenylate ester: W12 (≠ Y17), S37 (≠ N42), G38 (= G43), C39 (= C44), G40 (= G45), K41 (= K46), S42 (= S47), T43 (= T48), Q81 (= Q88), R128 (≠ Q139), A132 (≠ T143), S134 (= S145), G136 (= G147), Q137 (= Q148), E158 (= E169), H191 (= H202)
- binding magnesium ion: S42 (= S47), Q81 (= Q88)
3puxA Crystal structure of an outward-facing mbp-maltose transporter complex bound to adp-bef3 (see paper)
29% identity, 83% coverage: 6:231/271 of query aligns to 1:220/371 of 3puxA
- binding adenosine-5'-diphosphate: W12 (≠ Y17), G38 (= G43), C39 (= C44), G40 (= G45), K41 (= K46), S42 (= S47), T43 (= T48), R128 (≠ Q139), S134 (= S145), Q137 (= Q148)
- binding beryllium trifluoride ion: S37 (≠ N42), G38 (= G43), K41 (= K46), Q81 (= Q88), S134 (= S145), G136 (= G147), H191 (= H202)
- binding magnesium ion: S42 (= S47), Q81 (= Q88)
3puwA Crystal structure of an outward-facing mbp-maltose transporter complex bound to adp-alf4 (see paper)
29% identity, 83% coverage: 6:231/271 of query aligns to 1:220/371 of 3puwA
- binding adenosine-5'-diphosphate: W12 (≠ Y17), V17 (= V22), G38 (= G43), C39 (= C44), G40 (= G45), K41 (= K46), S42 (= S47), T43 (= T48), R128 (≠ Q139), A132 (≠ T143), S134 (= S145), Q137 (= Q148)
- binding tetrafluoroaluminate ion: S37 (≠ N42), G38 (= G43), K41 (= K46), Q81 (= Q88), S134 (= S145), G135 (= G146), G136 (= G147), E158 (= E169), H191 (= H202)
- binding magnesium ion: S42 (= S47), Q81 (= Q88)
3puvA Crystal structure of an outward-facing mbp-maltose transporter complex bound to adp-vo4 (see paper)
29% identity, 83% coverage: 6:231/271 of query aligns to 1:220/371 of 3puvA
- binding adenosine-5'-diphosphate: W12 (≠ Y17), V17 (= V22), G38 (= G43), C39 (= C44), G40 (= G45), K41 (= K46), S42 (= S47), T43 (= T48), R128 (≠ Q139), A132 (≠ T143), S134 (= S145), Q137 (= Q148)
- binding magnesium ion: S42 (= S47), Q81 (= Q88)
1q12A Crystal structure of the atp-bound e. Coli malk (see paper)
29% identity, 82% coverage: 11:231/271 of query aligns to 4:218/367 of 1q12A
- binding adenosine-5'-triphosphate: W10 (≠ Y17), S35 (≠ N42), G36 (= G43), C37 (= C44), G38 (= G45), K39 (= K46), S40 (= S47), T41 (= T48), R126 (≠ Q139), A130 (≠ T143), S132 (= S145), G134 (= G147), Q135 (= Q148)
1f3oA Crystal structure of mj0796 atp-binding cassette (see paper)
33% identity, 73% coverage: 24:222/271 of query aligns to 22:223/232 of 1f3oA
Sites not aligning to the query:
4yerA Crystal structure of an abc transporter atp-binding protein (tm_1403) from thermotoga maritima msb8 at 2.35 a resolution
27% identity, 82% coverage: 11:231/271 of query aligns to 8:223/285 of 4yerA
- binding adenosine-5'-diphosphate: F14 (≠ Y17), F17 (≠ Y20), N39 (= N42), G40 (= G43), G42 (= G45), K43 (= K46), T44 (≠ S47), T45 (= T48), T135 (= T143), F136 (≠ L144), S137 (= S145)
P19566 Maltose/maltodextrin import ATP-binding protein MalK; EC 7.5.2.1 from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) (see paper)
29% identity, 84% coverage: 5:231/271 of query aligns to 1:221/369 of P19566
- L86 (≠ T92) mutation to F: Loss of transport. No effect on ATP-binding activity but decrease in ATP hydrolysis. Retains repressor activity.
- P160 (= P170) mutation to L: Loss of transport. No effect on ATP-binding activity but decrease in ATP hydrolysis. Retains repressor activity.
- D165 (= D175) mutation to N: Loss of transport. No effect on ATP-binding activity but decrease in ATP hydrolysis. Retains repressor activity.
Sites not aligning to the query:
- 306 E→K: Loss of transport. No effect on ATP-binding and ATP hydrolysis. Retains repressor activity.
7mdyC Lolcde nucleotide-bound
33% identity, 77% coverage: 16:225/271 of query aligns to 15:223/226 of 7mdyC
- binding adp orthovanadate: G42 (= G43), S43 (≠ C44), G44 (= G45), K45 (= K46), S46 (= S47), T47 (= T48), Q91 (= Q88), H138 (≠ Q139), E142 (≠ T143), S144 (= S145), G145 (= G146), G146 (= G147), E168 (= E169), N172 (≠ W173), H201 (= H202)
- binding magnesium ion: S46 (= S47), Q91 (= Q88)
Sites not aligning to the query:
3c4jA Abc protein artp in complex with atp-gamma-s
31% identity, 81% coverage: 12:231/271 of query aligns to 8:225/242 of 3c4jA
3c41J Abc protein artp in complex with amp-pnp/mg2+
31% identity, 81% coverage: 12:231/271 of query aligns to 8:225/242 of 3c41J
2olkA Abc protein artp in complex with adp-beta-s
31% identity, 81% coverage: 12:231/271 of query aligns to 8:225/242 of 2olkA
Query Sequence
>14724 FitnessBrowser__Keio:14724
MTESVARLRGEQLTLGYGKYTVAENLTVEIPDGHFTAIIGPNGCGKSTLLRTLSRLMTPA
HGHVWLDGEHIQHYASKEVARRIGLLAQNATTPGDITVQELVARGRYPHQPLFTRWRKED
EEAVTKAMQATGITHLADQSVDTLSGGQRQRAWIAMVLAQETAIMLLDEPTTWLDISHQI
DLLELLSELNREKGYTLAAVLHDLNQACRYASHLIALREGKIVAQGAPKEIVTAELIERI
YGLRCMIIDDPVAGTPLVVPLGRTAPSTANS
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory