Comparing 14736 FitnessBrowser__Keio:14736 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 19 hits to proteins with known functional sites (download)
1kq3A Crystal structure of a glycerol dehydrogenase (tm0423) from thermotoga maritima at 1.5 a resolution (see paper)
33% identity, 98% coverage: 6:360/362 of query aligns to 3:357/364 of 1kq3A
Q9WYQ4 Glycerol dehydrogenase; GDH; GLDH; EC 1.1.1.6 from Thermotoga maritima (strain ATCC 43589 / DSM 3109 / JCM 10099 / NBRC 100826 / MSB8) (see paper)
33% identity, 98% coverage: 6:360/362 of query aligns to 2:356/364 of Q9WYQ4
1ta9B Crystal structure of glycerol dehydrogenase from schizosaccharomyces pombe
30% identity, 98% coverage: 7:360/362 of query aligns to 8:364/394 of 1ta9B
8gobA Crystal structure of glycerol dehydrogenase in the presence of NAD+ (see paper)
32% identity, 96% coverage: 7:354/362 of query aligns to 3:352/367 of 8gobA
8goaA Crystal structure of glycerol dehydrogenase in the absence of NAD+ (see paper)
32% identity, 96% coverage: 7:354/362 of query aligns to 3:352/367 of 8goaA
5zxlA Structure of glda from e.Coli (see paper)
32% identity, 96% coverage: 7:354/362 of query aligns to 3:352/367 of 5zxlA
P0A9S5 Glycerol dehydrogenase; GDH; GLDH; (R)-aminopropanol dehydrogenase; 1,2-propanediol dehydrogenase; D-1-amino-2-propanol oxidoreductase; EC 1.1.1.6; EC 1.1.1.75 from Escherichia coli (strain K12) (see paper)
32% identity, 96% coverage: 7:354/362 of query aligns to 3:352/367 of P0A9S5
O13702 Glycerol dehydrogenase 1; GDH; GLDH; EC 1.1.1.6 from Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast)
30% identity, 98% coverage: 7:360/362 of query aligns to 64:420/450 of O13702
4mcaA Crystal structure of glycerol dehydrogenase from serratia to 1.9a
35% identity, 81% coverage: 61:354/362 of query aligns to 56:352/367 of 4mcaA
Sites not aligning to the query:
3uhjA Crystal structure of a probable glycerol dehydrogenase from sinorhizobium meliloti 1021
31% identity, 98% coverage: 7:361/362 of query aligns to 3:354/357 of 3uhjA
5xn8A Structure of glycerol dehydrogenase crystallised as a contaminant
33% identity, 80% coverage: 67:354/362 of query aligns to 64:352/365 of 5xn8A
P32816 Glycerol dehydrogenase; GDH; GLDH; GlyDH; EC 1.1.1.6 from Geobacillus stearothermophilus (Bacillus stearothermophilus) (see 2 papers)
31% identity, 92% coverage: 7:339/362 of query aligns to 5:340/370 of P32816
1jq5A Bacillus stearothermophilus glycerol dehydrogenase complex with NAD+ (see paper)
31% identity, 92% coverage: 7:339/362 of query aligns to 4:339/366 of 1jq5A
1jqaA Bacillus stearothermophilus glycerol dehydrogenase complex with glycerol (see paper)
30% identity, 92% coverage: 7:339/362 of query aligns to 3:334/361 of 1jqaA
5fb3F Structure of glycerophosphate dehydrogenase in complex with NADPH (see paper)
28% identity, 74% coverage: 66:334/362 of query aligns to 51:312/337 of 5fb3F
Sites not aligning to the query:
4rgvA Crystal structure of the methanocaldococcus jannaschii g1pdh (see paper)
24% identity, 63% coverage: 90:317/362 of query aligns to 67:288/328 of 4rgvA
4rgqB Crystal structure of the methanocaldococcus jannaschii g1pdh with NADPH and dhap (see paper)
24% identity, 63% coverage: 90:317/362 of query aligns to 70:293/333 of 4rgqB
Sites not aligning to the query:
Q9YER2 Glycerol-1-phosphate dehydrogenase [NAD(P)+]; G1P dehydrogenase; G1PDH; Gro1PDH; Enantiomeric glycerophosphate synthase; sn-glycerol-1-phosphate dehydrogenase; EC 1.1.1.261 from Aeropyrum pernix (strain ATCC 700893 / DSM 11879 / JCM 9820 / NBRC 100138 / K1) (see paper)
26% identity, 71% coverage: 77:334/362 of query aligns to 79:326/352 of Q9YER2
3ce9A Crystal structure of glycerol dehydrogenase (np_348253.1) from clostridium acetobutylicum at 2.37 a resolution
28% identity, 24% coverage: 90:176/362 of query aligns to 87:170/349 of 3ce9A
Sites not aligning to the query:
>14736 FitnessBrowser__Keio:14736
MPHNPIRVVVGPANYFSHPGSFNHLHDFFTDEQLSRAVWIYGKRAIAAAQTKLPPAFGLP
GAKHILFRGHCSESDVQQLAAESGDDRSVVIGVGGGALLDTAKALARRLGLPFVAVPTIA
ATCAAWTPLSVWYNDAGQALHYEIFDDANFMVLVEPEIILNAPQQYLLAGIGDTLAKWYE
AVVLAPQPETLPLTVRLGINNAQAIRDVLLNSSEQALSDQQNQQLTQSFCDVVDAIIAGG
GMVGGLGDRFTRVAAAHAVHNGLTVLPQTEKFLHGTKVAYGILVQSALLGQDDVLAQLTG
AYQRFHLPTTLAELEVDINNQAEIDKVIAHTLRPVESIHYLPVTLTPDTLRAAFKKVESF
KA
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory