SitesBLAST
Comparing 14775 FitnessBrowser__Keio:14775 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
1h2fA Bacillus stearothermophilus phoe (previously known as yhfr) in complex with trivanadate (see paper)
29% identity, 82% coverage: 3:169/203 of query aligns to 4:170/207 of 1h2fA
- active site: R8 (= R7), H9 (= H8), N15 (= N14), R58 (= R57), E82 (= E81), H150 (= H149)
- binding phosphate ion: G142 (≠ Y141), E143 (≠ Q142)
- binding trivanadate: R8 (= R7), H9 (= H8), N15 (= N14), Q21 (≠ S20), R58 (= R57), E82 (= E81), H150 (= H149), G151 (≠ Q150), V152 (≠ G151)
Sites not aligning to the query:
1h2eA Bacillus stearothermophilus phoe (previously known as yhfr) in complex with phosphate (see paper)
29% identity, 82% coverage: 3:169/203 of query aligns to 4:170/207 of 1h2eA
4ij6A Crystal structure of a novel-type phosphoserine phosphatase mutant (h9a) from hydrogenobacter thermophilus tk-6 in complex with l-phosphoserine (see paper)
25% identity, 96% coverage: 1:194/203 of query aligns to 2:195/207 of 4ij6A
- active site: R8 (= R7), A9 (≠ H8), N15 (= N14), R58 (= R57), E82 (= E81), H150 (= H149)
- binding phosphoserine: R8 (= R7), Q21 (≠ S20), R58 (= R57), E82 (= E81), H85 (≠ F84), H150 (= H149), T151 (≠ Q150)
6m1xC Crystal structure of phosphoserine phosphatase in complex with 3- phosphoglyceric acid from entamoeba histolytica (see paper)
29% identity, 83% coverage: 2:170/203 of query aligns to 3:166/196 of 6m1xC
1k6mA Crystal structure of human liver 6-phosphofructo-2-kinase/fructose-2, 6-bisphosphatase (see paper)
27% identity, 84% coverage: 3:172/203 of query aligns to 215:377/432 of 1k6mA
Sites not aligning to the query:
- binding phosphothiophosphoric acid-adenylate ester: 13, 14, 15, 16, 17, 18, 92, 120, 131, 134, 135, 136, 184, 210
6ic0A Human pfkfb3 in complex with a n-aryl 6-aminoquinoxaline inhibitor 4 (see paper)
30% identity, 84% coverage: 3:172/203 of query aligns to 231:393/428 of 6ic0A
Sites not aligning to the query:
- binding 3-[[8-(1-methylindol-6-yl)quinoxalin-6-yl]amino]-~{N}-pyrimidin-5-yl-pyridine-4-carboxamide: 28, 29, 32, 33, 135, 137, 146, 149, 197, 200, 224, 226, 404
- binding pyrophosphate 2-: 26, 27, 28, 29, 30, 31, 32, 151, 407
6ibxA Human pfkfb3 in complex with a n-aryl 6-aminoquinoxaline inhibitor 5 (see paper)
30% identity, 84% coverage: 3:172/203 of query aligns to 231:393/429 of 6ibxA
Sites not aligning to the query:
- binding 3-[[8-(1-methylindol-6-yl)quinoxalin-6-yl]amino]-~{N}-[(3~{S})-1-methylpiperidin-3-yl]pyridine-4-carboxamide: 28, 32, 33, 135, 137, 142, 146, 149, 150, 197, 224
- binding pyrophosphate 2-: 27, 28, 29, 30, 31, 32, 151, 407
2i1vB Crystal structure of pfkfb3 in complex with adp and fructose-2,6- bisphosphate (see paper)
30% identity, 84% coverage: 3:172/203 of query aligns to 244:406/449 of 2i1vB
- binding 6-O-phosphono-beta-D-fructofuranose: I260 (≠ Y19), G261 (≠ S20), E318 (= E81), Y329 (≠ H92), R343 (≠ W106), K347 (vs. gap), Y358 (≠ F121), Q384 (= Q150), R388 (≠ S154)
- binding phosphonic acid: R248 (= R7), H249 (= H8), N255 (= N14), H383 (= H149)
Sites not aligning to the query:
- binding adenosine-5'-diphosphate: 39, 40, 41, 42, 43, 44, 45, 159, 163, 164, 213, 420
- binding 2,6-di-O-phosphono-beta-D-fructofuranose: 67, 70, 83, 121, 122, 128, 185, 189
2dwoA Pfkfb3 in complex with adp and pep (see paper)
30% identity, 84% coverage: 3:172/203 of query aligns to 244:406/449 of 2dwoA
- active site: R248 (= R7), H249 (= H8), N255 (= N14), S298 (≠ R57), E318 (= E81), H383 (= H149)
- binding 6-O-phosphono-beta-D-fructofuranose: I260 (≠ Y19), G261 (≠ S20), E318 (= E81), Y329 (≠ H92), R343 (≠ W106), K347 (vs. gap), Y358 (≠ F121), Q384 (= Q150), R388 (≠ S154)
Sites not aligning to the query:
- binding adenosine-5'-diphosphate: 39, 40, 41, 42, 43, 44, 45, 148, 159, 162, 163, 164, 239, 420
- binding 6-O-phosphono-beta-D-fructofuranose: 436
- binding phosphoenolpyruvate: 70, 83, 94, 122, 189
3qpuA Pfkfb3 in complex with ppi (see paper)
30% identity, 84% coverage: 3:172/203 of query aligns to 241:403/439 of 3qpuA
Sites not aligning to the query:
- binding pyrophosphate 2-: 36, 37, 38, 39, 40, 41, 42, 64, 67, 91, 119, 160, 161, 186, 417
2dwpA A pseudo substrate complex of 6-phosphofructo-2-kinase of pfkfb (see paper)
30% identity, 84% coverage: 3:172/203 of query aligns to 234:396/431 of 2dwpA
- active site: R238 (= R7), H239 (= H8), N245 (= N14), S288 (≠ R57), E308 (= E81), H373 (= H149)
- binding 6-O-phosphono-beta-D-fructofuranose: I250 (≠ Y19), G251 (≠ S20), E308 (= E81), Y319 (≠ H92), R333 (≠ W106), K337 (vs. gap), Y348 (≠ F121), Q374 (= Q150), R378 (≠ S154)
Sites not aligning to the query:
- binding phosphomethylphosphonic acid adenylate ester: 29, 30, 31, 32, 33, 34, 35, 138, 149, 152, 153, 154, 203, 410
- binding 6-O-phosphono-beta-D-fructofuranose: 57, 60, 111, 112, 118, 175, 179, 426
6ibyA Human pfkfb3 in complex with a n-aryl 6-aminoquinoxaline inhibitor 6 (see paper)
30% identity, 84% coverage: 3:172/203 of query aligns to 230:392/428 of 6ibyA
Sites not aligning to the query:
- binding 3-[[8-(1-methylindol-6-yl)quinoxalin-6-yl]amino]-~{N}-[(3~{S})-1-methylpyrrolidin-3-yl]pyridine-4-carboxamide: 27, 31, 32, 134, 136, 145, 148, 196, 199, 200, 223
- binding pyrophosphate 2-: 25, 26, 27, 28, 29, 30, 31, 150, 406
6hvjA Human pfkfb3 in complex with a n-aryl 6-aminoquinoxaline inhibitor 3 (see paper)
30% identity, 84% coverage: 3:172/203 of query aligns to 232:394/430 of 6hvjA
- active site: R236 (= R7), H237 (= H8), N243 (= N14), S286 (≠ R57), E306 (= E81), H371 (= H149)
- binding 6-O-phosphono-beta-D-fructofuranose: G249 (≠ S20), E306 (= E81), Y317 (≠ H92), R331 (≠ W106), K335 (vs. gap), Y346 (≠ F121), Q372 (= Q150), R376 (≠ S154)
Sites not aligning to the query:
- binding 8-(3-methyl-1-benzofuran-5-yl)-~{N}-(4-methylsulfonylpyridin-3-yl)quinoxalin-6-amine: 29, 33, 34, 136, 138, 143, 147, 151, 198, 225, 407
- binding phosphate ion: 28, 29, 30, 31, 32, 152
5ajzA Human pfkfb3 in complex with an indole inhibitor 5 (see paper)
30% identity, 84% coverage: 3:172/203 of query aligns to 243:405/440 of 5ajzA
- active site: R247 (= R7), H248 (= H8), N254 (= N14), S297 (≠ R57), E317 (= E81), H382 (= H149)
- binding 6-O-phosphono-beta-D-fructofuranose: G260 (≠ S20), E317 (= E81), Y328 (≠ H92), R342 (≠ W106), K346 (vs. gap), Y357 (≠ F121), Q383 (= Q150), R387 (≠ S154)
- binding phosphonic acid: R247 (= R7), H248 (= H8), N254 (= N14), H382 (= H149), Q383 (= Q150)
Sites not aligning to the query:
- binding 2-azanyl-N-[4-[(3-cyano-1H-indol-5-yl)oxy]phenyl]ethanamide: 40, 41, 44, 45, 154, 158, 212, 213, 233, 236, 238
2axnA Crystal structure of the human inducible form 6-phosphofructo-2- kinase/fructose-2,6-bisphosphatase (see paper)
30% identity, 84% coverage: 3:172/203 of query aligns to 244:406/451 of 2axnA
- active site: R248 (= R7), H249 (= H8), N255 (= N14), S298 (≠ R57), E318 (= E81), H383 (= H149)
- binding 6-O-phosphono-beta-D-fructofuranose: I260 (≠ Y19), G261 (≠ S20), E318 (= E81), Y329 (≠ H92), R343 (≠ W106), K347 (vs. gap), Y358 (≠ F121), Q384 (= Q150), R388 (≠ S154)
Sites not aligning to the query:
- binding adenosine-5'-diphosphate: 39, 40, 41, 42, 43, 44, 45, 148, 159, 162, 163, 164, 420
- binding {[-(bis-carboxymethyl-amino)-ethyl]-carboxymethyl-amino}-acetic acid: 39, 43, 65, 67, 70, 71, 83, 121, 122, 189
- binding 6-O-phosphono-beta-D-fructofuranose: 436
4ma4A S-glutathionylated pfkfb3 (see paper)
30% identity, 84% coverage: 3:172/203 of query aligns to 239:401/444 of 4ma4A
- active site: R243 (= R7), H244 (= H8), N250 (= N14), S293 (≠ R57), E313 (= E81), H378 (= H149)
- binding 6-O-phosphono-beta-D-fructofuranose: G256 (≠ S20), E313 (= E81), Y324 (≠ H92), R338 (≠ W106), K342 (vs. gap), Y353 (≠ F121), Q379 (= Q150), R383 (≠ S154)
Sites not aligning to the query:
- binding adenosine-5'-diphosphate: 35, 36, 37, 38, 39, 40, 143, 154, 158, 159, 415
- binding glutathione: 121, 195, 196
6hviA Human pfkfb3 in complex with a n-aryl 6-aminoquinoxaline inhibitor 2 (see paper)
30% identity, 84% coverage: 3:172/203 of query aligns to 235:397/433 of 6hviA
- active site: R239 (= R7), H240 (= H8), N246 (= N14), S289 (≠ R57), E309 (= E81), H374 (= H149)
- binding 6-O-phosphono-beta-D-fructofuranose: G252 (≠ S20), E309 (= E81), Y320 (≠ H92), R334 (≠ W106), K338 (vs. gap), Y349 (≠ F121), Q375 (= Q150), R379 (≠ S154)
Sites not aligning to the query:
- binding 8-[3-(dimethylamino)phenyl]-~{N}-(4-methylsulfonylpyridin-3-yl)quinoxalin-6-amine: 32, 33, 36, 37, 139, 141, 146, 150, 153, 201, 204, 228, 230
- binding pyrophosphate 2-: 31, 32, 33, 34, 35, 36, 155, 411
5ak0A Human pfkfb3 in complex with an indole inhibitor 6 (see paper)
30% identity, 84% coverage: 3:172/203 of query aligns to 245:407/442 of 5ak0A
- active site: R249 (= R7), H250 (= H8), N256 (= N14), S299 (≠ R57), E319 (= E81), H384 (= H149)
- binding 6-O-phosphono-beta-D-fructofuranose: G262 (≠ S20), E319 (= E81), Y330 (≠ H92), R344 (≠ W106), K348 (vs. gap), Y359 (≠ F121), Q385 (= Q150), R389 (≠ S154)
- binding phosphonic acid: R249 (= R7), H250 (= H8), H384 (= H149), Q385 (= Q150)
Sites not aligning to the query:
- binding (2s)-n-[4-[1-methyl-3-(1-methylpyrazol-4-yl)indol-5-yl]oxyphenyl]pyrrolidine-2-carboxamide: 42, 46, 47, 149, 159, 161, 214, 215, 218, 235, 236, 238
4d4lA Human pfkfb3 in complex with a pyrrolopyrimidone compound
30% identity, 84% coverage: 3:172/203 of query aligns to 245:407/442 of 4d4lA
- active site: R249 (= R7), H250 (= H8), N256 (= N14), S299 (≠ R57), E319 (= E81), H384 (= H149)
- binding 6-O-phosphono-beta-D-fructofuranose: I261 (≠ Y19), G262 (≠ S20), E319 (= E81), Y330 (≠ H92), R344 (≠ W106), K348 (vs. gap), Y359 (≠ F121), Q385 (= Q150), R389 (≠ S154)
- binding phosphonic acid: R249 (= R7), H250 (= H8), N256 (= N14), H384 (= H149), Q385 (= Q150)
Sites not aligning to the query:
- binding 5-(4-chlorophenyl)-7-phenyl-3,7-dihydro-4H-pyrrolo[2,3-d]pyrimidin-4-one: 42, 43, 46, 47, 156, 160, 163, 211, 214, 240
- binding 6-O-phosphono-beta-D-fructofuranose: 437
4d4jA Human pfkfb3 in complex with a pyrrolopyrimidone compound
30% identity, 84% coverage: 3:172/203 of query aligns to 245:407/442 of 4d4jA
- active site: R249 (= R7), H250 (= H8), N256 (= N14), S299 (≠ R57), E319 (= E81), H384 (= H149)
- binding 6-O-phosphono-beta-D-fructofuranose: I261 (≠ Y19), G262 (≠ S20), E319 (= E81), Y330 (≠ H92), R344 (≠ W106), K348 (vs. gap), Y359 (≠ F121), Q385 (= Q150), R389 (≠ S154)
- binding phosphonic acid: R249 (= R7), H250 (= H8), E319 (= E81), H384 (= H149), Q385 (= Q150)
Sites not aligning to the query:
- binding 5-(4-bromophenyl)-7-phenyl-3,7-dihydro-4H-pyrrolo[2,3-d]pyrimidin-4-one: 42, 43, 46, 47, 156, 160, 163, 211, 214, 235, 238, 240
Query Sequence
>14775 FitnessBrowser__Keio:14775
MRLWLIRHGETQANIDGLYSGHAPTPLTARGIEQAQNLHTLLHGVSFDLVLCSELERAQH
TARLVLSDRQLPVQIIPELNEMFFGDWEMRHHRDLMQEDAENYSAWCNDWQHAIPTNGEG
FQAFSQRVERFIARLSEFQHYQNILVVSHQGVLSLLIARLIGMPAEAMWHFRVDQGCWSA
IDINQKFATLRVLNSRAIGVENA
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory