SitesBLAST
Comparing 14792 FitnessBrowser__Keio:14792 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
2ia4B Crystal structure of novel amino acid binding protein from shigella flexneri
99% identity, 92% coverage: 25:302/302 of query aligns to 1:278/278 of 2ia4B
- binding glutamic acid: R23 (= R47), S71 (= S95), R74 (= R98), S89 (= S113), T90 (= T114), T91 (= T115), R96 (= R120), T138 (= T162), T139 (= T163), H163 (= H187), M180 (= M204), D181 (= D205)
2vhaA Debp (see paper)
99% identity, 91% coverage: 26:301/302 of query aligns to 1:276/276 of 2vhaA
- binding glutamic acid: R22 (= R47), S70 (= S95), R73 (= R98), S88 (= S113), T89 (= T114), T90 (= T115), R95 (= R120), T137 (= T162), T138 (= T163), H162 (= H187), M179 (= M204), D180 (= D205)
8ovoA X-ray structure of the sf-iglusnfr-s72a in complex with l-aspartate
99% identity, 82% coverage: 28:274/302 of query aligns to 1:247/503 of 8ovoA
5t0wA Crystal structure of the ancestral amino acid-binding protein anccdt- 1, a precursor of cyclohexadienyl dehydratase
31% identity, 80% coverage: 31:271/302 of query aligns to 1:229/229 of 5t0wA
- binding arginine: D17 (≠ R47), Y20 (≠ S50), W58 (≠ S95), S75 (≠ G112), G76 (≠ S113), M77 (≠ T114), T78 (= T115), R83 (= R120), Q126 (≠ T159), T129 (= T162), T130 (= T163), D168 (= D206)
5eyfB Crystal structure of solute-binding protein from enterococcus faecium with bound glutamate
29% identity, 78% coverage: 42:277/302 of query aligns to 15:241/243 of 5eyfB
4zv1A An ancestral arginine-binding protein bound to arginine (see paper)
31% identity, 76% coverage: 40:270/302 of query aligns to 4:225/226 of 4zv1A
- binding arginine: E11 (≠ R47), F14 (≠ S50), F52 (≠ S95), A69 (≠ G112), G70 (≠ S113), M71 (≠ T114), T72 (= T115), R77 (= R120), Q117 (≠ T159), S120 (≠ T162), T121 (= T163), D161 (= D205)
4zv2A An ancestral arginine-binding protein bound to glutamine (see paper)
31% identity, 76% coverage: 40:270/302 of query aligns to 4:223/225 of 4zv2A
6svfA Crystal structure of the p235gk mutant of argbp from t. Maritima (see paper)
27% identity, 79% coverage: 33:270/302 of query aligns to 3:227/229 of 6svfA
- binding arginine: F20 (≠ S50), F58 (≠ S95), S75 (≠ G112), G76 (≠ S113), M77 (≠ T114), T78 (= T115), R83 (= R120), Q124 (≠ T159), T127 (= T162), T128 (= T163), D165 (= D205)
2yjpA Crystal structure of the solute receptors for l-cysteine of neisseria gonorrhoeae (see paper)
26% identity, 79% coverage: 31:268/302 of query aligns to 2:229/247 of 2yjpA
- binding cysteine: F18 (≠ R47), K21 (≠ S50), R65 (= R98), N80 (≠ S113), F81 (≠ T114), T82 (= T115), R87 (= R120), T129 (= T162), T130 (= T163), H167 (≠ M204), D168 (= D205)
- binding zinc ion: E61 (≠ T94), H139 (≠ N172), E141 (= E174), D148 (≠ K185)
4ymxA Crystal structure of the substrate binding protein of an amino acid abc transporter (see paper)
27% identity, 77% coverage: 40:271/302 of query aligns to 1:223/224 of 4ymxA
- binding arginine: S8 (≠ R47), D10 (≠ S49), F11 (≠ S50), F52 (≠ V88), A69 (≠ G112), G70 (≠ S113), M71 (≠ T114), T72 (= T115), R77 (= R120), Q116 (≠ T159), T119 (= T162), T120 (= T163), E157 (≠ D205)
2v25A Structure of the campylobacter jejuni antigen peb1a, an aspartate and glutamate receptor with bound aspartate (see paper)
25% identity, 77% coverage: 33:265/302 of query aligns to 3:229/231 of 2v25A
1xt8B Crystal structure of cysteine-binding protein from campylobacter jejuni at 2.0 a resolution (see paper)
23% identity, 80% coverage: 31:271/302 of query aligns to 5:235/251 of 1xt8B
3k4uE Crystal structure of putative binding component of abc transporter from wolinella succinogenes dsm 1740 complexed with lysine
25% identity, 76% coverage: 40:270/302 of query aligns to 4:226/234 of 3k4uE
- binding lysine: E11 (≠ R47), Y14 (≠ S50), W52 (≠ S95), G70 (≠ S113), T72 (= T115), R77 (= R120), K120 (≠ S160), V123 (≠ T162), S124 (≠ T163), E144 (≠ H187), D162 (= D205)
4g4pA Crystal structure of glutamine-binding protein from enterococcus faecalis at 1.5 a (see paper)
26% identity, 75% coverage: 43:270/302 of query aligns to 17:234/235 of 4g4pA
- binding glutamine: F24 (≠ S50), F62 (≠ S95), A79 (≠ G112), G80 (≠ S113), M81 (≠ T114), S82 (≠ T115), R87 (= R120), K127 (≠ T159), T130 (= T162), E131 (≠ T163), D171 (= D205)
3vv5A Crystal structure of ttc0807 complexed with (s)-2-aminoethyl-l- cysteine (aec) (see paper)
24% identity, 81% coverage: 32:277/302 of query aligns to 5:237/237 of 3vv5A
- binding l-thialysine: E20 (≠ R47), F23 (≠ S50), N27 (≠ S54), F61 (≠ S95), A78 (≠ G112), S79 (= S113), G81 (≠ T115), R86 (= R120), T127 (= T162), T128 (= T163), Y129 (≠ S164)
3vvfA Crystal structure of ttc0807 complexed with arginine (see paper)
24% identity, 81% coverage: 32:277/302 of query aligns to 9:241/241 of 3vvfA
- binding arginine: E24 (≠ R47), F27 (≠ S50), F65 (≠ S95), A82 (≠ G112), S83 (= S113), H84 (≠ T114), G85 (≠ T115), R90 (= R120), Q128 (≠ T159), T131 (= T162), T132 (= T163), Y133 (≠ S164), E196 (= E232)
3vveA Crystal structure of ttc0807 complexed with lysine (see paper)
24% identity, 81% coverage: 32:277/302 of query aligns to 9:241/241 of 3vveA
- binding lysine: E24 (≠ R47), F27 (≠ S50), F65 (≠ S95), S83 (= S113), H84 (≠ T114), R90 (= R120), Q128 (≠ T159), T131 (= T162), T132 (= T163), Y133 (≠ S164), E196 (= E232)
3vvdA Crystal structure of ttc0807 complexed with ornithine (see paper)
24% identity, 81% coverage: 32:277/302 of query aligns to 9:241/241 of 3vvdA
- binding L-ornithine: E24 (≠ R47), F65 (≠ S95), S83 (= S113), H84 (≠ T114), G85 (≠ T115), R90 (= R120), Q128 (≠ T159), T131 (= T162), T132 (= T163), Y133 (≠ S164), E196 (= E232)
P02911 Lysine/arginine/ornithine-binding periplasmic protein; LAO-binding protein from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) (see 4 papers)
26% identity, 86% coverage: 10:270/302 of query aligns to 5:253/260 of P02911
- D33 (≠ R47) binding ; binding ; binding ; mutation to A: Decreases arginine and histidine binding affinity.
- Y36 (≠ S50) mutation to A: Shows a drastic decrease in arginine and histidine binding affinity.
- D52 (≠ S66) mutation to A: Shows a drastic decrease in arginine and histidine binding affinity.
- C60 (≠ V77) modified: Disulfide link with 67
- C67 (≠ L90) modified: Disulfide link with 60
- F74 (vs. gap) mutation to A: Shows a drastic decrease in arginine and histidine binding affinity.
- S91 (≠ G112) binding ; binding ; mutation to A: Has no effect on the arginine and histidine binding affinity.
- S92 (= S113) binding ; binding ; binding ; mutation to A: Decreases arginine and histidine binding affinity.
- S94 (≠ T115) binding ; binding ; binding ; mutation to A: Decreases arginine and histidine binding affinity.
- R99 (= R120) binding ; binding ; binding ; mutation to A: Shows a drastic decrease in arginine and histidine binding affinity.
- L139 (≠ T159) mutation to K: Changes ligand specificity. Can bind glutamine. Still able to bind basic amino acids, however, with 1000-fold less affinity for arginine.; mutation to Q: Does not affect ligand preference.
- T143 (= T163) binding ; binding ; binding
- D183 (= D205) binding ; binding ; mutation to A: Shows a drastic decrease in arginine and histidine binding affinity.
P02910 Histidine-binding periplasmic protein; HBP from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) (see 2 papers)
25% identity, 76% coverage: 42:270/302 of query aligns to 28:253/260 of P02910
- E40 (≠ S54) mutation to K: Decrease in ATPase-inducing activity and histidine transport; when associated with K-47.
- K42 (≠ Y56) mutation to E: Increases ATPase-inducing activity and histidine transport; when associated with K-47.
- E47 (≠ K61) mutation to K: Decrease in ATPase-inducing activity and histidine transport; when associated with K-40. Increases ATPase-inducing activity and histidine transport; when associated with E-42.
- D171 (≠ T193) mutation D->A,N: Strong decrease in ATPase-inducing activity and histidine transport.
- R176 (= R198) mutation R->D,S: Strong decrease in ATPase-inducing activity and histidine transport.
- D178 (≠ V200) mutation to A: Slight decrease in ATPase-inducing activity and histidine transport.
Sites not aligning to the query:
Query Sequence
>14792 FitnessBrowser__Keio:14792
MQLRKPATAILALALSAGLAQADDAAPAAGSTLDKIAKNGVIVVGHRESSVPFSYYDNQQ
KVVGYSQDYSNAIVEAVKKKLNKPDLQVKLIPITSQNRIPLLQNGTFDFECGSTTNNVER
QKQAAFSDTIFVVGTRLLTKKGGDIKDFANLKDKAVVVTSGTTSEVLLNKLNEEQKMNMR
IISAKDHGDSFRTLESGRAVAFMMDDALLAGERAKAKKPDNWEIVGKPQSQEAYGCMLRK
DDPQFKKLMDDTIAQVQTSGEAEKWFDKWFKNPIPPKNLNMNFELSDEMKALFKEPNDKA
LN
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory