SitesBLAST
Comparing 14818 FitnessBrowser__Keio:14818 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
2fuvA Phosphoglucomutase from salmonella typhimurium.
98% identity, 100% coverage: 2:546/546 of query aligns to 1:545/545 of 2fuvA
Q9VUY9 Phosphoglucomutase; PGM; Glucose phosphomutase; EC 5.4.2.2 from Drosophila melanogaster (Fruit fly) (see 4 papers)
29% identity, 78% coverage: 22:447/546 of query aligns to 3:427/560 of Q9VUY9
- E6 (≠ Q25) natural variant: E -> G
- K17 (= K41) natural variant: K -> Q
- K28 (≠ H54) natural variant: K -> N
- T36 (≠ L62) natural variant: T -> M
- S116 (= S146) modified: Phosphoserine
- E351 (≠ K365) natural variant: E -> K
1wqaA Crystal structure of pyrococcus horikoshii phosphomannomutase/phosphoglucomutase complexed with mg2+
25% identity, 88% coverage: 42:521/546 of query aligns to 5:433/455 of 1wqaA
- active site: R11 (= R48), S101 (= S146), H102 (= H147), K111 (= K156), D243 (= D304), D245 (= D306), D247 (= D308), R248 (= R309), G330 (= G394), R340 (≠ K409)
- binding magnesium ion: S101 (= S146), D243 (= D304), D245 (= D306), D247 (= D308)
7pjcB The structure of candida albicans phosphoglucomutase with isothiazolone modification on cys359
26% identity, 92% coverage: 41:544/546 of query aligns to 14:539/553 of 7pjcB
P18159 Phosphoglucomutase; PGM; Alpha-phosphoglucomutase; Glucose phosphomutase; EC 5.4.2.2 from Bacillus subtilis (strain 168) (see paper)
26% identity, 88% coverage: 40:518/546 of query aligns to 42:546/581 of P18159
- G162 (= G162) mutation to D: Very low enzymatic activity. Great decrease in biofilm formation. Deformed cell morphology.
- T240 (≠ S239) mutation to I: Impaired enzymatic activity. Great decrease in biofilm formation. Deformed cell morphology.
- G407 (= G394) mutation to D: Loss of enzymatic activity. Great decrease in biofilm formation. Deformed cell morphology.
- D418 (= D410) mutation to N: Impaired enzymatic activity. Great decrease in biofilm formation. Deformed cell morphology.
6snqA Crystal structures of human pgm1 isoform 2 (see paper)
26% identity, 77% coverage: 38:458/546 of query aligns to 26:451/566 of 6snqA
- active site: R36 (= R48), S130 (= S146), H131 (= H147), K143 (= K156), D301 (= D304), D303 (= D306), D305 (= D308), R306 (= R309), G393 (= G394)
- binding 6-O-phosphono-alpha-D-glucopyranose: S130 (= S146), T370 (≠ V371), G371 (= G372), E389 (= E390), S391 (= S392)
- binding zinc ion: S130 (= S146), D301 (= D304), D303 (= D306), D305 (= D308)
Sites not aligning to the query:
6snoA Crystal structures of human pgm1 isoform 2 (see paper)
26% identity, 77% coverage: 38:458/546 of query aligns to 26:451/573 of 6snoA
- active site: R36 (= R48), S130 (= S146), H131 (= H147), K143 (= K156), D301 (= D304), D303 (= D306), D305 (= D308), R306 (= R309), G393 (= G394)
- binding 1-O-phosphono-alpha-D-glucopyranose: S130 (= S146), E389 (= E390), S391 (= S392)
- binding zinc ion: S130 (= S146), D301 (= D304), D303 (= D306), D305 (= D308)
Sites not aligning to the query:
3pmgA Structure of rabbit muscle phosphoglucomutase at 2.4 angstroms resolution. Use of freezing point depressant and reduced temperature to enhance diffractivity (see paper)
28% identity, 69% coverage: 83:458/546 of query aligns to 58:437/561 of 3pmgA
- active site: S116 (= S146), H117 (= H147), K129 (= K156), D287 (= D304), D289 (= D306), D291 (= D308), R292 (= R309), G379 (= G394), K388 (= K409)
- binding magnesium ion: S116 (= S146), D287 (= D304), D289 (= D306), D291 (= D308)
Sites not aligning to the query:
1c4gA Phosphoglucomutase vanadate based transition state analog complex
28% identity, 69% coverage: 83:458/546 of query aligns to 58:437/561 of 1c4gA
- active site: S116 (= S146), H117 (= H147), K129 (= K156), D287 (= D304), D289 (= D306), D291 (= D308), R292 (= R309), G379 (= G394), K388 (= K409)
- binding cobalt (ii) ion: S116 (= S146), D287 (= D304), D289 (= D306), D291 (= D308)
- binding alpha-d-glucose-1-phosphate-6-vanadate: S116 (= S146), H117 (= H147), K129 (= K156), R292 (= R309), E375 (= E390), S377 (= S392), K388 (= K409)
Sites not aligning to the query:
1c47A Binding driven structural changes in crystaline phosphoglucomutase associated with chemical reaction
28% identity, 69% coverage: 83:458/546 of query aligns to 58:437/561 of 1c47A
- active site: S116 (= S146), H117 (= H147), K129 (= K156), D287 (= D304), D289 (= D306), D291 (= D308), R292 (= R309), G379 (= G394), K388 (= K409)
- binding 1,6-di-O-phosphono-alpha-D-glucopyranose: S116 (= S146), D291 (= D308), R292 (= R309), E375 (= E390), K388 (= K409)
Sites not aligning to the query:
P00949 Phosphoglucomutase-1; PGM 1; Glucose phosphomutase 1; EC 5.4.2.2 from Oryctolagus cuniculus (Rabbit) (see 2 papers)
28% identity, 69% coverage: 83:458/546 of query aligns to 59:438/562 of P00949
- S117 (= S146) active site, Phosphoserine intermediate; binding ; binding via phosphate group; modified: Phosphoserine
- D288 (= D304) binding
- D290 (= D306) binding
- D292 (= D308) binding ; binding
- R293 (= R309) binding
- T357 (≠ V371) binding
- E376 (= E390) binding
- S378 (= S392) binding
- K389 (= K409) binding
Sites not aligning to the query:
6y8yA Structure of baltic herring (clupea harengus) phosphoglucomutase 5 (pgm5) with bound glucose-1-phosphate (see paper)
26% identity, 77% coverage: 41:458/546 of query aligns to 25:447/572 of 6y8yA
Sites not aligning to the query:
1kfqA Crystal structure of exocytosis-sensitive phosphoprotein, pp63/parafusin (phosphoglucomutse) from paramecium. Open form (see paper)
25% identity, 77% coverage: 28:447/546 of query aligns to 11:448/571 of 1kfqA
1kfiA Crystal structure of the exocytosis-sensitive phosphoprotein, pp63/parafusin (phosphoglucomutase) from paramecium (see paper)
25% identity, 77% coverage: 28:447/546 of query aligns to 10:447/570 of 1kfiA
- active site: S124 (= S146), H125 (= H147), D306 (= D304), D308 (= D306), D310 (= D308), R311 (= R309), K403 (= K409)
- binding sulfate ion: S124 (= S146), H125 (= H147), D310 (= D308), R311 (= R309)
- binding zinc ion: D306 (= D304), D308 (= D306), D310 (= D308)
Sites not aligning to the query:
P36871 Phosphoglucomutase-1; PGM 1; Glucose phosphomutase 1; EC 5.4.2.2 from Homo sapiens (Human) (see 11 papers)
27% identity, 69% coverage: 83:458/546 of query aligns to 59:438/562 of P36871
- D62 (= D86) to H: in CDG1T; reduces solubility; reduces strongly phosphoglucomutase activity; dbSNP:rs587777403
- K68 (≠ E92) to M: in allele PGM1*7+, allele PGM1*7-, allele PGM1*3+ and allele PGM1*3-; phosphoglucomutase activity is similar to wild-type; dbSNP:rs200390982
- T115 (= T144) to A: in CDG1T; reduces mildly phosphoglucomutase activity; dbSNP:rs121918371
- S117 (= S146) active site, Phosphoserine intermediate; binding via phosphate groupe; modified: Phosphoserine
- G121 (vs. gap) to R: in CDG1T; there is 7% enzyme residual phosphoglucomutase activity; dbSNP:rs398122912
- R221 (≠ G232) to C: in allele PGM1*2+, allele PGM1*2-, allele PGM1*3+ and allele PGM1*3-; phosphoglucomutase activity is similar to wild-type; dbSNP:rs1126728
- D263 (= D272) to G: in CDG1T; strongly reduces phosphoglucomutase activity; dbSNP:rs1465877146; to Y: in CDG1T; strongly reduces phosphoglucomutase activity; dbSNP:rs587777404
- D288 (= D304) binding
- D290 (= D306) binding
- G291 (≠ Y307) to R: in CDG1T; strongly reduces phosphoglucomutase activity; dbSNP:rs772768778
- D292 (= D308) binding
- G330 (≠ A344) to R: in CDG1T; decreases mildly solubility; dbSNP:rs777164338
- E377 (= E391) to K: in CDG1T; decreases strongly solubility
- E388 (≠ D408) to K: in CDG1T; decreases strongly solubility; dbSNP:rs1301021797
- Y420 (≠ F440) to H: in allele PGM1*1-, allele PGM1*2-, allele PGM1*3- and allele PGM1*7-; phosphoglucomutase activity is similar to wild-type; dbSNP:rs11208257
Sites not aligning to the query:
- 19 T → A: in CDG1T; strongly reduces phosphoglucomutase activity; dbSNP:rs1320810473
- 38 N → Y: in CDG1T; strongly reduces solubility; increases aggregation; dbSNP:rs587777402
- 41 Q → R: in CDG1T; reduces solubility; increases aggregation; dbSNP:rs1300651770
- 467 modified: Phosphothreonine; by PAK1
- 516 L → P: in CDG1T; decreases strongly solubility; dbSNP:rs587777401
7p5oB Crystal structure of aspergillus fumigatus phosphoglucomutase in complex with the reaction intermediate
25% identity, 89% coverage: 41:528/546 of query aligns to 18:523/558 of 7p5oB
- binding 1,6-di-O-phosphono-alpha-D-glucopyranose: T21 (= T44), R25 (= R48), S117 (= S146), H118 (= H147), K130 (= K156), D286 (= D308), R287 (= R309), T350 (≠ V371), E369 (= E390), S371 (= S392), K382 (= K409), R499 (= R507), S501 (= S509), G502 (= G510), T503 (= T511), R511 (≠ K516)
- binding magnesium ion: S117 (= S146), D282 (= D304), D284 (= D306), D286 (= D308)
5jn5A Crystal structure of the d263y missense variant of human pgm1 (see paper)
27% identity, 69% coverage: 83:458/546 of query aligns to 60:439/559 of 5jn5A
- active site: S118 (= S146), H119 (= H147), K131 (= K156), D289 (= D304), D291 (= D306), D293 (= D308), R294 (= R309), G381 (= G394), K390 (= K409)
- binding calcium ion: S118 (= S146), D289 (= D304), D291 (= D306), D293 (= D308)
Sites not aligning to the query:
7s0wB Crystal structure of the t337m variant of human pgm-1 (see paper)
28% identity, 66% coverage: 83:441/546 of query aligns to 60:422/499 of 7s0wB
4qg5A Crystal structure of phosphoglucomutase from leishmania major at 3.5 angstrom resolution
26% identity, 85% coverage: 83:544/546 of query aligns to 30:540/565 of 4qg5A
O74374 Phosphoglucomutase; PGM; Glucose phosphomutase; EC 5.4.2.2 from Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast) (see paper)
27% identity, 71% coverage: 43:430/546 of query aligns to 16:400/554 of O74374
- T111 (= T144) modified: Phosphothreonine
- S113 (= S146) modified: Phosphoserine
Query Sequence
>14818 FitnessBrowser__Keio:14818
MAIHNRAGQPAQQSDLINVAQLTAQYYVLKPEAGNAEHAVKFGTSGHRGSAARHSFNEPH
ILAIAQAIAEERAKNGITGPCYVGKDTHALSEPAFISVLEVLAANGVDVIVQENNGFTPT
PAVSNAILVHNKKGGPLADGIVITPSHNPPEDGGIKYNPPNGGPADTNVTKVVEDRANAL
LADGLKGVKRISLDEAMASGHVKEQDLVQPFVEGLADIVDMAAIQKAGLTLGVDPLGGSG
IEYWKRIGEYYNLNLTIVNDQVDQTFRFMHLDKDGAIRMDCSSECAMAGLLALRDKFDLA
FANDPDYDRHGIVTPAGLMNPNHYLAVAINYLFQHRPQWGKDVAVGKTLVSSAMIDRVVN
DLGRKLVEVPVGFKWFVDGLFDGSFGFGGEESAGASFLRFDGTPWSTDKDGIIMCLLAAE
ITAVTGKNPQEHYNELAKRFGAPSYNRLQAAATSAQKAALSKLSPEMVSASTLAGDPITA
RLTAAPGNGASIGGLKVMTDNGWFAARPSGTEDAYKIYCESFLGEEHRKQIEKEAVEIVS
EVLKNA
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory