Comparing 14879 FitnessBrowser__Keio:14879 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
1kflA Crystal structure of phenylalanine-regulated 3-deoxy-d-arabino- heptulosonate-7-phosphate synthase (dahp synthase) from e.Coli complexed with mn2+, pep, and phe (see paper)
100% identity, 100% coverage: 1:350/350 of query aligns to 1:350/350 of 1kflA
P0AB91 Phospho-2-dehydro-3-deoxyheptonate aldolase, Phe-sensitive; 3-deoxy-D-arabino-heptulosonate 7-phosphate synthase; DAHP synthase; Phospho-2-keto-3-deoxyheptonate aldolase; EC 2.5.1.54 from Escherichia coli (strain K12) (see paper)
100% identity, 100% coverage: 1:350/350 of query aligns to 1:350/350 of P0AB91
5cksB Dahp (3-deoxy-d-arabinoheptulosonate-7-phosphate) synthase in complex with dahp oxime. (see paper)
100% identity, 99% coverage: 6:350/350 of query aligns to 1:345/345 of 5cksB
8e0sD Dahp (3-deoxy-d-arabinoheptulosonate-7-phosphate) synthase complexed with dahp oxime in unbound:(bound)2:unbound conformations (see paper)
100% identity, 98% coverage: 7:349/350 of query aligns to 1:343/343 of 8e0sD
7rudB Dahp synthase complex with trifluoropyruvate oxime (see paper)
100% identity, 98% coverage: 7:349/350 of query aligns to 1:343/343 of 7rudB
1gg1A Crystal structure analysis of dahp synthase in complex with mn2+ and 2-phosphoglycolate (see paper)
99% identity, 98% coverage: 7:349/350 of query aligns to 1:339/339 of 1gg1A
1qr7A Crystal structure of phenylalanine-regulated 3-deoxy-d-arabino- heptulosonate-7-phosphate synthase from escherichia coli complexed with pb2+ and pep (see paper)
99% identity, 98% coverage: 8:350/350 of query aligns to 1:338/338 of 1qr7A
7rueA Dahp synthase complexed with trifluoropyruvate semicarbazone (see paper)
98% identity, 99% coverage: 5:349/350 of query aligns to 1:339/339 of 7rueA
5cksA Dahp (3-deoxy-d-arabinoheptulosonate-7-phosphate) synthase in complex with dahp oxime. (see paper)
98% identity, 99% coverage: 5:350/350 of query aligns to 1:339/339 of 5cksA
8e0sA Dahp (3-deoxy-d-arabinoheptulosonate-7-phosphate) synthase complexed with dahp oxime in unbound:(bound)2:unbound conformations (see paper)
98% identity, 98% coverage: 7:350/350 of query aligns to 1:336/336 of 8e0sA
5dcdA Neisseria meningitidis 3-deoxy-d-arabino-heptulosonate 7-phosphate synthase regulated (tyrosine)
65% identity, 99% coverage: 2:348/350 of query aligns to 1:343/346 of 5dcdA
5dcbC Neisseria meningitidis 3-deoxy-d-arabino-heptulosonate 7-phosphate synthase regulated and complexed with pep
65% identity, 99% coverage: 2:348/350 of query aligns to 3:345/348 of 5dcbC
5dceA Neisseria meningitidis 3-deoxy-d-arabino-heptulosonate 7-phosphate synthase regulated (tryptophan) (see paper)
65% identity, 98% coverage: 5:348/350 of query aligns to 2:341/344 of 5dceA
4hsoA Crystal structure of s213g variant dah7ps from neisseria meningitidis (see paper)
65% identity, 98% coverage: 5:348/350 of query aligns to 2:341/345 of 4hsoA
4umbA Structural analysis of substrate-mimicking inhibitors in complex with neisseria meningitidis 3-deoxy-d-arabino-heptulosonate 7-phosphate synthase - the importance of accommodating the active site water (see paper)
66% identity, 96% coverage: 14:348/350 of query aligns to 1:331/335 of 4umbA
4umcA Structural analysis of substrate-mimicking inhibitors in complex with neisseria meningitidis 3-deoxy-d-arabino-heptulosonate 7-phosphate synthase - the importance of accommodating the active site water (see paper)
66% identity, 96% coverage: 14:348/350 of query aligns to 1:331/334 of 4umcA
4umaA Structural analysis of substrate-mimicking inhibitors in complex with neisseria meningitidis 3 deoxy d arabino heptulosonate 7 phosphate synthase the importance of accommodating the active site water (see paper)
66% identity, 95% coverage: 15:348/350 of query aligns to 1:330/333 of 4umaA
3tqkA Structure of phospho-2-dehydro-3-deoxyheptonate aldolase from francisella tularensis schu s4 (see paper)
55% identity, 97% coverage: 10:350/350 of query aligns to 2:341/341 of 3tqkA
1ofoA Crystal structure of the tyrosine regulated 3-deoxy-d-arabino- heptulosonate-7-phosphate synthase from saccharomyces cerevisiae in complex with 2-phosphoglycolate (see paper)
58% identity, 98% coverage: 7:349/350 of query aligns to 1:340/344 of 1ofoA
1of8A Double complex of the tyrosine sensitive dahp synthase from s. Cerevisiae with co2+, pep and the e4p analogoue g3p (see paper)
57% identity, 98% coverage: 8:349/350 of query aligns to 1:336/339 of 1of8A
>14879 FitnessBrowser__Keio:14879
MNYQNDDLRIKEIKELLPPVALLEKFPATENAANTVAHARKAIHKILKGNDDRLLVVIGP
CSIHDPVAAKEYATRLLALREELKDELEIVMRVYFEKPRTTVGWKGLINDPHMDNSFQIN
DGLRIARKLLLDINDSGLPAAGEFLDMITPQYLADLMSWGAIGARTTESQVHRELASGLS
CPVGFKNGTDGTIKVAIDAINAAGAPHCFLSVTKWGHSAIVNTSGNGDCHIILRGGKEPN
YSAKHVAEVKEGLNKAGLPAQVMIDFSHANSSKQFKKQMDVCADVCQQIAGGEKAIIGVM
VESHLVEGNQSLESGEPLAYGKSITDACIGWEDTDALLRQLANAVKARRG
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory