Comparing 14895 FitnessBrowser__Keio:14895 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 4 hits to proteins with known functional sites (download)
Q9FMF7 Dicarboxylate transporter 2.1, chloroplastic; AtpDCT1; Glutamate/malate translocator from Arabidopsis thaliana (Mouse-ear cress) (see paper)
33% identity, 97% coverage: 9:471/477 of query aligns to 99:560/563 of Q9FMF7
6okzB Structure of vcindy bound to fumarate
26% identity, 74% coverage: 57:411/477 of query aligns to 46:388/444 of 6okzB
7t9gA Structure of vcindy-na+ (see paper)
26% identity, 74% coverage: 57:411/477 of query aligns to 47:389/445 of 7t9gA
Sites not aligning to the query:
6wtxA Structure of vcindy in complex with terephthalate (see paper)
26% identity, 74% coverage: 57:411/477 of query aligns to 47:389/445 of 6wtxA
Sites not aligning to the query:
>14895 FitnessBrowser__Keio:14895
MNKKSLWKLILILAIPCIIGFMPAPAGLSELAWVLFGIYLAAIVGLVIKPFPEPVVLLIA
VAASMVVVGNLSDGAFKTTAVLSGYSSGTTWLVFSAFTLSAAFVTTGLGKRIAYLLIGKI
GNTTLGLGYVTVFLDLVLAPATPSNTARAGGIVLPIINSVAVALGSEPEKSPRRVGHYLM
MSIYMVTKTTSYMFFTAMAGNILALKMINDILHLQISWGGWALAAGLPGIIMLLVTPLVI
YTMYPPEIKKVDNKTIAKAGLAELGPMKIREKMLLGVFVLALLGWIFSKSLGVDESTVAI
VVMATMLLLGIVTWEDVVKNKGGWNTLIWYGGIIGLSSLLSKVKFFEWLAEVFKNNLAFD
GHGNVAFFVIIFLSIIVRYFFASGSAYIVAMLPVFAMLANVSGAPLMLTALALLFSNSYG
GMVTHYGGAAGPVIFGVGYNDIKSWWLVGAVLTILTFLVHITLGVWWWNMLIGWNML
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory