Comparing 14934 FitnessBrowser__Keio:14934 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
4ymuJ Crystal structure of an amino acid abc transporter complex with arginines and atps (see paper)
58% identity, 100% coverage: 1:239/240 of query aligns to 1:239/240 of 4ymuJ
4u00A Crystal structure of ttha1159 in complex with adp (see paper)
59% identity, 100% coverage: 1:239/240 of query aligns to 2:239/241 of 4u00A
3c4jA Abc protein artp in complex with atp-gamma-s
55% identity, 100% coverage: 1:239/240 of query aligns to 3:241/242 of 3c4jA
3c41J Abc protein artp in complex with amp-pnp/mg2+
55% identity, 100% coverage: 1:239/240 of query aligns to 3:241/242 of 3c41J
2olkA Abc protein artp in complex with adp-beta-s
55% identity, 100% coverage: 1:239/240 of query aligns to 3:241/242 of 2olkA
2oljA Abc protein artp in complex with adp/mg2+
55% identity, 100% coverage: 1:239/240 of query aligns to 3:241/242 of 2oljA
1b0uA Atp-binding subunit of the histidine permease from salmonella typhimurium (see paper)
53% identity, 97% coverage: 6:237/240 of query aligns to 7:250/258 of 1b0uA
P02915 Histidine/lysine/arginine/ornithine transport ATP-binding protein HisP; EC 7.4.2.1 from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) (see paper)
53% identity, 97% coverage: 6:237/240 of query aligns to 11:254/258 of P02915
5xu1B Structure of a non-canonical abc transporter from streptococcus pneumoniae r6 (see paper)
46% identity, 90% coverage: 1:217/240 of query aligns to 3:223/226 of 5xu1B
1f3oA Crystal structure of mj0796 atp-binding cassette (see paper)
48% identity, 89% coverage: 1:214/240 of query aligns to 1:223/232 of 1f3oA
1l2tA Dimeric structure of mj0796, a bacterial abc transporter cassette (see paper)
47% identity, 89% coverage: 1:214/240 of query aligns to 1:223/230 of 1l2tA
P30750 Methionine import ATP-binding protein MetN; EC 7.4.2.11 from Escherichia coli (strain K12) (see 3 papers)
38% identity, 99% coverage: 1:237/240 of query aligns to 1:242/343 of P30750
Sites not aligning to the query:
6cvlD Crystal structure of the escherichia coli atpgs-bound metni methionine abc transporter in complex with its metq binding protein (see paper)
38% identity, 99% coverage: 1:237/240 of query aligns to 2:243/344 of 6cvlD
3tuzC Inward facing conformations of the metni methionine abc transporter: cy5 semet soak crystal form (see paper)
38% identity, 99% coverage: 1:237/240 of query aligns to 2:243/344 of 3tuzC
Sites not aligning to the query:
3tuiC Inward facing conformations of the metni methionine abc transporter: cy5 native crystal form (see paper)
38% identity, 99% coverage: 1:237/240 of query aligns to 2:243/344 of 3tuiC
P19566 Maltose/maltodextrin import ATP-binding protein MalK; EC 7.5.2.1 from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) (see paper)
41% identity, 98% coverage: 2:236/240 of query aligns to 4:234/369 of P19566
Sites not aligning to the query:
2awnB Crystal structure of the adp-mg-bound e. Coli malk (crystallized with atp-mg) (see paper)
41% identity, 98% coverage: 2:236/240 of query aligns to 3:233/374 of 2awnB
3puyA Crystal structure of an outward-facing mbp-maltose transporter complex bound to amp-pnp after crystal soaking of the pretranslocation state (see paper)
41% identity, 98% coverage: 2:236/240 of query aligns to 3:233/371 of 3puyA
3puxA Crystal structure of an outward-facing mbp-maltose transporter complex bound to adp-bef3 (see paper)
41% identity, 98% coverage: 2:236/240 of query aligns to 3:233/371 of 3puxA
3puwA Crystal structure of an outward-facing mbp-maltose transporter complex bound to adp-alf4 (see paper)
41% identity, 98% coverage: 2:236/240 of query aligns to 3:233/371 of 3puwA
>14934 FitnessBrowser__Keio:14934
MIEFKNVSKHFGPTQVLHNIDLNIAQGEVVVIIGPSGSGKSTLLRCINKLEEITSGDLIV
DGLKVNDPKVDERLIRQEAGMVFQQFYLFPHLTALENVMFGPLRVRGANKEEAEKLAREL
LAKVGLAERAHHYPSELSGGQQQRVAIARALAVKPKMMLFDEPTSALDPELRHEVLKVMQ
DLAEEGMTMVIVTHEIGFAEKVASRLIFIDKGRIAEDGNPQVLIKNPPSQRLQEFLQHVS
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory