Comparing 14936 FitnessBrowser__Keio:14936 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
8eyzA Engineered glutamine binding protein bound to gln and a cobaloxime ligand (see paper)
99% identity, 91% coverage: 23:248/248 of query aligns to 1:226/226 of 8eyzA
4zv2A An ancestral arginine-binding protein bound to glutamine (see paper)
46% identity, 88% coverage: 27:244/248 of query aligns to 6:224/225 of 4zv2A
4zv1A An ancestral arginine-binding protein bound to arginine (see paper)
46% identity, 88% coverage: 27:244/248 of query aligns to 6:226/226 of 4zv1A
2pvuA Crystal structures of the arginine-, lysine-, histidine-binding protein artj from the thermophilic bacterium geobacillus stearothermophilus (see paper)
43% identity, 92% coverage: 22:248/248 of query aligns to 2:229/235 of 2pvuA
2q2aA Crystal structures of the arginine-, lysine-, histidine-binding protein artj from the thermophilic bacterium geobacillus stearothermophilus (see paper)
43% identity, 92% coverage: 22:248/248 of query aligns to 8:235/241 of 2q2aA
2q2cA Crystal structures of the arginine-, lysine-, histidine-binding protein artj from the thermophilic bacterium geobacillus stearothermophilus (see paper)
43% identity, 90% coverage: 25:248/248 of query aligns to 1:225/231 of 2q2cA
4g4pA Crystal structure of glutamine-binding protein from enterococcus faecalis at 1.5 a (see paper)
42% identity, 88% coverage: 25:243/248 of query aligns to 14:234/235 of 4g4pA
5t0wA Crystal structure of the ancestral amino acid-binding protein anccdt- 1, a precursor of cyclohexadienyl dehydratase
42% identity, 88% coverage: 27:243/248 of query aligns to 12:228/229 of 5t0wA
4ymxA Crystal structure of the substrate binding protein of an amino acid abc transporter (see paper)
38% identity, 88% coverage: 27:243/248 of query aligns to 3:222/224 of 4ymxA
6svfA Crystal structure of the p235gk mutant of argbp from t. Maritima (see paper)
38% identity, 88% coverage: 27:243/248 of query aligns to 12:227/229 of 6svfA
2pyyB Crystal structure of the glur0 ligand-binding core from nostoc punctiforme in complex with (l)-glutamate (see paper)
38% identity, 79% coverage: 48:243/248 of query aligns to 19:210/217 of 2pyyB
Sites not aligning to the query:
4zefA Crystal structure of substrate binding domain 2 (sbd2) of abc transporter glnpq from enterococcus faecalis
39% identity, 86% coverage: 25:238/248 of query aligns to 16:231/239 of 4zefA
4kqpA Crystal structure of lactococcus lactis glnp substrate binding domain 2 (sbd2) in complex with glutamine at 0.95 a resolution (see paper)
35% identity, 88% coverage: 28:246/248 of query aligns to 9:229/230 of 4kqpA
P02911 Lysine/arginine/ornithine-binding periplasmic protein; LAO-binding protein from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) (see 4 papers)
31% identity, 98% coverage: 2:243/248 of query aligns to 3:253/260 of P02911
4h5fA Crystal structure of an amino acid abc transporter substrate-binding protein from streptococcus pneumoniae canada mdr_19a bound to l- arginine, form 1
34% identity, 87% coverage: 26:241/248 of query aligns to 12:233/240 of 4h5fA
4i62A 1.05 angstrom crystal structure of an amino acid abc transporter substrate-binding protein abpa from streptococcus pneumoniae canada mdr_19a bound to l-arginine
33% identity, 88% coverage: 26:243/248 of query aligns to 9:231/237 of 4i62A
5owfA Structure of a lao-binding protein mutant with glutamine (see paper)
31% identity, 87% coverage: 29:243/248 of query aligns to 5:228/235 of 5owfA
5eyfB Crystal structure of solute-binding protein from enterococcus faecium with bound glutamate
35% identity, 81% coverage: 48:248/248 of query aligns to 38:239/243 of 5eyfB
3k4uE Crystal structure of putative binding component of abc transporter from wolinella succinogenes dsm 1740 complexed with lysine
31% identity, 88% coverage: 26:243/248 of query aligns to 5:226/234 of 3k4uE
1lstA Three-dimensional structures of the periplasmic lysine-, arginine-, ornithine-binding protein with and without a ligand (see paper)
30% identity, 87% coverage: 29:243/248 of query aligns to 8:231/238 of 1lstA
>14936 FitnessBrowser__Keio:14936
MKSVLKVSLAALTLAFAVSSHAADKKLVVATDTAFVPFEFKQGDKYVGFDVDLWAAIAKE
LKLDYELKPMDFSGIIPALQTKNVDLALAGITITDERKKAIDFSDGYYKSGLLVMVKANN
NDVKSVKDLDGKVVAVKSGTGSVDYAKANIKTKDLRQFPNIDNAYMELGTNRADAVLHDT
PNILYFIKTAGNGQFKAVGDSLEAQQYGIAFPKGSDELRDKVNGALKTLRENGTYNEIYK
KWFGTEPK
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory