Comparing 14953 FitnessBrowser__Keio:14953 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
P37595 Isoaspartyl peptidase; Beta-aspartyl-peptidase; EcAIII; Isoaspartyl dipeptidase; EC 3.4.19.5 from Escherichia coli (strain K12) (see 2 papers)
100% identity, 100% coverage: 1:321/321 of query aligns to 1:321/321 of P37595
1jn9A Structure of putative asparaginase encoded by escherichia coli ybik gene (see paper)
100% identity, 49% coverage: 2:159/321 of query aligns to 1:158/158 of 1jn9A
8c0iAAA Isoaspartyl peptidase subunit alpha (see paper)
100% identity, 49% coverage: 2:157/321 of query aligns to 1:156/156 of 8c0iAAA
2zalB Crystal structure of e. Coli isoaspartyl aminopeptidase/l-asparaginase in complex with l-aspartate (see paper)
100% identity, 42% coverage: 179:313/321 of query aligns to 1:135/135 of 2zalB
8c23DDD Isoaspartyl peptidase subunit beta (see paper)
99% identity, 42% coverage: 179:313/321 of query aligns to 1:135/135 of 8c23DDD
Q7L266 Isoaspartyl peptidase/L-asparaginase; Asparaginase-like protein 1; Beta-aspartyl-peptidase; Isoaspartyl dipeptidase; L-asparagine amidohydrolase; EC 3.4.19.5; EC 3.5.1.1 from Homo sapiens (Human) (see 4 papers)
38% identity, 93% coverage: 5:304/321 of query aligns to 4:290/308 of Q7L266
4pvrA Crystal structure of partially-cleaved human l-asparaginase protein in complex with l-aspartate (see paper)
38% identity, 93% coverage: 5:304/321 of query aligns to 5:280/298 of 4pvrA
4osxA Structure of uncleaved glycine-bound human l-asparaginase protein (see paper)
38% identity, 93% coverage: 5:304/321 of query aligns to 5:282/300 of 4osxA
4o0hA Crystal structure of human l-asparaginase protein with covalently linked substrate l-asparagine (see paper)
38% identity, 93% coverage: 5:304/321 of query aligns to 5:277/295 of 4o0hA
4o48A Crystal structure of cleaved guinea pig l-asparaginase type iii in complex with l-aspartate (see paper)
37% identity, 91% coverage: 5:295/321 of query aligns to 5:273/298 of 4o48A
1p4vA Crystal structure of the glycosylasparaginase precursor d151n mutant with glycine (see paper)
36% identity, 90% coverage: 32:320/321 of query aligns to 15:289/295 of 1p4vA
Q47898 N(4)-(Beta-N-acetylglucosaminyl)-L-asparaginase; Aspartylglucosaminidase; AGA; Glycosylasparaginase; N4-(N-acetyl-beta-glucosaminyl)-L-asparagine amidase; EC 3.5.1.26 from Elizabethkingia miricola (Chryseobacterium miricola) (see 5 papers)
36% identity, 90% coverage: 32:320/321 of query aligns to 60:334/340 of Q47898
Sites not aligning to the query:
4r4yA Structural basis of a point mutation that causes the genetic disease aspartylglucosaminuria (see paper)
36% identity, 90% coverage: 32:320/321 of query aligns to 13:287/293 of 4r4yA
2gezB Crystal structure of potassium-independent plant asparaginase (see paper)
58% identity, 37% coverage: 179:298/321 of query aligns to 1:117/133 of 2gezB
Q9H6P5 Threonine aspartase 1; Taspase-1; EC 3.4.25.- from Homo sapiens (Human) (see 2 papers)
33% identity, 75% coverage: 6:246/321 of query aligns to 44:307/420 of Q9H6P5
4pu6B Crystal structure of potassium-dependent plant-type l-asparaginase from phaseolus vulgaris in complex with k+ cations (see paper)
52% identity, 37% coverage: 179:298/321 of query aligns to 1:117/131 of 4pu6B
2gezC Crystal structure of potassium-independent plant asparaginase (see paper)
42% identity, 50% coverage: 6:167/321 of query aligns to 5:165/166 of 2gezC
2a8jB Crystal structure of human taspase1 (acivated form) (see paper)
32% identity, 75% coverage: 6:246/321 of query aligns to 4:214/313 of 2a8jB
4pv2C Crystal structure of potassium-dependent plant-type l-asparaginase from phaseolus vulgaris in complex with k+ and na+ cations (see paper)
41% identity, 45% coverage: 2:146/321 of query aligns to 1:143/158 of 4pv2C
P20933 N(4)-(beta-N-acetylglucosaminyl)-L-asparaginase; Aspartylglucosaminidase; Glycosylasparaginase; N4-(N-acetyl-beta-glucosaminyl)-L-asparagine amidase; EC 3.5.1.26 from Homo sapiens (Human) (see 11 papers)
29% identity, 71% coverage: 36:264/321 of query aligns to 40:290/346 of P20933
Sites not aligning to the query:
>14953 FitnessBrowser__Keio:14953
MGKAVIAIHGGAGAISRAQMSLQQELRYIEALSAIVETGQKMLEAGESALDVVTEAVRLL
EECPLFNAGIGAVFTRDETHELDACVMDGNTLKAGAVAGVSHLRNPVLAARLVMEQSPHV
MMIGEGAENFAFARGMERVSPEIFSTSLRYEQLLAARKEGATVLDHSGAPLDEKQKMGTV
GAVALDLDGNLAAATSTGGMTNKLPGRVGDSPLVGAGCYANNASVAVSCTGTGEVFIRAL
AAYDIAALMDYGGLSLAEACERVVMEKLPALGGSGGLIAIDHEGNVALPFNTEGMYRAWG
YAGDTPTTGIYREKGDTVATQ
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory