Comparing 14985 FitnessBrowser__Keio:14985 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
2y7iA Structural basis for high arginine specificity in salmonella typhimurium periplasmic binding protein stm4351. (see paper)
59% identity, 92% coverage: 19:241/243 of query aligns to 4:227/228 of 2y7iA
4zv2A An ancestral arginine-binding protein bound to glutamine (see paper)
43% identity, 91% coverage: 23:243/243 of query aligns to 6:225/225 of 4zv2A
4zv1A An ancestral arginine-binding protein bound to arginine (see paper)
43% identity, 90% coverage: 23:241/243 of query aligns to 6:225/226 of 4zv1A
3tqlA Structure of the amino acid abc transporter, periplasmic amino acid- binding protein from coxiella burnetii. (see paper)
49% identity, 91% coverage: 21:241/243 of query aligns to 2:225/225 of 3tqlA
P02910 Histidine-binding periplasmic protein; HBP from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) (see 2 papers)
41% identity, 91% coverage: 21:241/243 of query aligns to 26:253/260 of P02910
Sites not aligning to the query:
1hslA Refined 1.89 angstroms structure of the histidine-binding protein complexed with histidine and its relationship with many other active transport(slash)chemosensory receptors (see paper)
41% identity, 91% coverage: 21:241/243 of query aligns to 4:231/238 of 1hslA
6svfA Crystal structure of the p235gk mutant of argbp from t. Maritima (see paper)
38% identity, 90% coverage: 26:243/243 of query aligns to 15:229/229 of 6svfA
P0AEU0 Histidine-binding periplasmic protein; HBP from Escherichia coli (strain K12) (see 3 papers)
40% identity, 91% coverage: 21:241/243 of query aligns to 26:253/260 of P0AEU0
Sites not aligning to the query:
P02911 Lysine/arginine/ornithine-binding periplasmic protein; LAO-binding protein from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) (see 4 papers)
36% identity, 99% coverage: 1:241/243 of query aligns to 1:253/260 of P02911
5owfA Structure of a lao-binding protein mutant with glutamine (see paper)
36% identity, 91% coverage: 21:241/243 of query aligns to 1:228/235 of 5owfA
1lstA Three-dimensional structures of the periplasmic lysine-, arginine-, ornithine-binding protein with and without a ligand (see paper)
36% identity, 91% coverage: 21:241/243 of query aligns to 4:231/238 of 1lstA
1lahE Structural bases for multiple ligand specificity of the periplasmic lysine-, arginine-, ornithine-binding protein (see paper)
36% identity, 91% coverage: 21:241/243 of query aligns to 4:231/238 of 1lahE
1lagE Structural bases for multiple ligand specificity of the periplasmic lysine-, arginine-, ornithine-binding protein (see paper)
36% identity, 91% coverage: 21:241/243 of query aligns to 4:231/238 of 1lagE
1lafE Structural bases for multiple ligand specificity of the periplasmic lysine-, arginine-, ornithine-binding protein (see paper)
36% identity, 91% coverage: 21:241/243 of query aligns to 4:231/238 of 1lafE
4ymxA Crystal structure of the substrate binding protein of an amino acid abc transporter (see paper)
36% identity, 91% coverage: 23:243/243 of query aligns to 3:224/224 of 4ymxA
5otcA Structure of the periplasmic binding protein (pbp) noct from agrobacterium tumefaciens c58 in complex with noroctopinic acid. (see paper)
31% identity, 91% coverage: 21:241/243 of query aligns to 2:248/256 of 5otcA
5otaA Structure of the periplasmic binding protein (pbp) noct from agrobacterium tumefaciens c58 in complex with octopinic acid (see paper)
31% identity, 91% coverage: 21:241/243 of query aligns to 2:248/254 of 5otaA
5ot9A Structure of the periplasmic binding protein (pbp) noct from a.Tumefaciens c58 in complex with histopine. (see paper)
31% identity, 91% coverage: 21:241/243 of query aligns to 2:248/254 of 5ot9A
4powA Structure of the pbp noct in complex with pyronopaline (see paper)
31% identity, 91% coverage: 21:241/243 of query aligns to 2:248/254 of 4powA
5t0wA Crystal structure of the ancestral amino acid-binding protein anccdt- 1, a precursor of cyclohexadienyl dehydratase
35% identity, 90% coverage: 23:241/243 of query aligns to 12:228/229 of 5t0wA
>14985 FitnessBrowser__Keio:14985
MKKLVLAALLASFTFGASAAEKINFGVSATYPPFESIGANNEIVGFDIDLAKALCKQMQA
ECTFTNHAFDSLIPSLKFRKYDAVISGMDITPERSKQVSFTTPYYENSAVVIAKKDTYKT
FADLKGKRIGMENGTTHQKYIQDQHPEVKTVSYDSYQNAFIDLKNGRIDGVFGDTAVVNE
WLKTNPQLGVATEKVTDPQYFGTGLGIAVRPDNKALLEKLNNALAAIKADGTYQKISDQW
FPQ
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory