Comparing 15241 FitnessBrowser__Keio:15241 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
Q8ZPZ9 N-acetyl-D-glucosamine kinase; GlcNAc kinase; EC 2.7.1.59 from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
93% identity, 100% coverage: 1:303/303 of query aligns to 1:303/303 of Q8ZPZ9
2ap1A Crystal structure of the putative regulatory protein
93% identity, 100% coverage: 1:303/303 of query aligns to 3:305/305 of 2ap1A
7p9lAAA Ubiquitin-like protein SMT3,N-acetyl-D-glucosamine kinase
60% identity, 99% coverage: 1:301/303 of query aligns to 2:303/303 of 7p9lAAA
7p9pAAA Ubiquitin-like protein SMT3,N-acetyl-D-glucosamine kinase
60% identity, 99% coverage: 1:301/303 of query aligns to 3:304/304 of 7p9pAAA
7p7wBBB Ubiquitin-like protein SMT3,N-acetyl-D-glucosamine kinase
60% identity, 99% coverage: 1:301/303 of query aligns to 5:306/306 of 7p7wBBB
4db3A 1.95 angstrom resolution crystal structure of n-acetyl-d-glucosamine kinase from vibrio vulnificus.
55% identity, 100% coverage: 1:302/303 of query aligns to 9:310/311 of 4db3A
6jdbA Crystal structure of n-acetyl mannosmaine kinase in complex with mannac-6p and adp from haemophilus influenzae
27% identity, 97% coverage: 5:298/303 of query aligns to 6:283/290 of 6jdbA
6jdoA Crystal structure of n-acetyl mannosmaine kinase with amp-pnp from pasteurella multocida
26% identity, 97% coverage: 5:298/303 of query aligns to 6:284/293 of 6jdoA
6jdhA Crystal structure of n-acetyl mannosmaine kinase from pasteurella multocida
26% identity, 97% coverage: 5:298/303 of query aligns to 6:284/293 of 6jdhA
2qm1B Crystal structure of glucokinase from enterococcus faecalis
29% identity, 98% coverage: 4:301/303 of query aligns to 10:320/325 of 2qm1B
3vovB Crystal structure of rok hexokinase from thermus thermophilus (see paper)
32% identity, 99% coverage: 4:303/303 of query aligns to 5:297/298 of 3vovB
P32718 D-allose kinase; Allokinase; EC 2.7.1.55 from Escherichia coli (strain K12) (see paper)
29% identity, 98% coverage: 4:299/303 of query aligns to 10:295/309 of P32718
Q93LQ8 Beta-glucoside kinase; EC 2.7.1.85 from Klebsiella pneumoniae (see paper)
27% identity, 97% coverage: 5:298/303 of query aligns to 6:283/297 of Q93LQ8
6jdcA Crystal structure of n-acetyl mannosmaine kinase in complex with mannac from haemophilus influenzae
26% identity, 97% coverage: 5:298/303 of query aligns to 6:263/269 of 6jdcA
3vglA Crystal structure of a rok family glucokinase from streptomyces griseus in complex with glucose and amppnp (see paper)
31% identity, 85% coverage: 1:257/303 of query aligns to 2:263/312 of 3vglA
Sites not aligning to the query:
3vgkB Crystal structure of a rok family glucokinase from streptomyces griseus (see paper)
31% identity, 85% coverage: 1:257/303 of query aligns to 2:263/312 of 3vgkB
5f7rA Rok repressor lmo0178 from listeria monocytogenes bound to inducer (see paper)
25% identity, 79% coverage: 60:299/303 of query aligns to 64:300/306 of 5f7rA
Sites not aligning to the query:
2aa4A Crystal structure of escherichia coli putative n-acetylmannosamine kinase, new york structural genomics consortium
30% identity, 83% coverage: 5:255/303 of query aligns to 6:243/289 of 2aa4A
P45425 N-acetylmannosamine kinase; ManNAc kinase; N-acetyl-D-mannosamine kinase; EC 2.7.1.60 from Escherichia coli (strain K12) (see paper)
30% identity, 83% coverage: 5:255/303 of query aligns to 6:243/291 of P45425
5f7qE Rok repressor lmo0178 from listeria monocytogenes bound to operator (see paper)
24% identity, 79% coverage: 60:299/303 of query aligns to 145:384/396 of 5f7qE
Sites not aligning to the query:
>15241 FitnessBrowser__Keio:15241
MYYGFDIGGTKIALGVFDSGRQLQWEKRVPTPRDSYDAFLDAVCELVAEADQRFGCKGSV
GIGIPGMPETEDGTLYAANVPAASGKPLRADLSARLDRDVRLDNDANCFALSEAWDDEFT
QYPLVMGLILGTGVGGGLIFNGKPITGKSYITGEFGHMRLPVDALTMMGLDFPLRRCGCG
QHGCIENYLSGRGFAWLYQHYYHQPLQAPEIIALYDQGDEQARAHVERYLDLLAVCLGNI
LTIVDPDLVVIGGGLSNFPAITTQLADRLPRHLLPVARVPRIERARHGDAGGMRGAAFLH
LTD
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory