Comparing 15245 FitnessBrowser__Keio:15245 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
P0AFK9 Spermidine/putrescine-binding periplasmic protein; SPBP from Escherichia coli (strain K12) (see 3 papers)
100% identity, 100% coverage: 1:348/348 of query aligns to 1:348/348 of P0AFK9
1poy1 Spermidine/putrescine-binding protein complexed with spermidine (dimer form) (see paper)
100% identity, 93% coverage: 26:348/348 of query aligns to 1:323/323 of 1poy1
7xjnA Structure of vcpotd1 in complex with norspermidine
66% identity, 92% coverage: 26:346/348 of query aligns to 2:321/322 of 7xjnA
4eqbA 1.5 angstrom crystal structure of spermidine/putrescine abc transporter substrate-binding protein potd from streptococcus pneumoniae strain canada mdr_19a in complex with calcium and hepes
43% identity, 85% coverage: 29:325/348 of query aligns to 4:298/323 of 4eqbA
Sites not aligning to the query:
Q9I6J1 Putrescine-binding periplasmic protein SpuD from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1) (see paper)
39% identity, 93% coverage: 1:322/348 of query aligns to 2:340/367 of Q9I6J1
3ttmA Crystal structure of spud in complex with putrescine (see paper)
39% identity, 86% coverage: 25:322/348 of query aligns to 1:315/341 of 3ttmA
Q9I6J0 Spermidine-binding periplasmic protein SpuE from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1) (see paper)
37% identity, 89% coverage: 9:316/348 of query aligns to 9:332/365 of Q9I6J0
3ttnA Crystal structures of polyamine receptors spud and spue from pseudomonas aeruginosa (see paper)
38% identity, 83% coverage: 28:316/348 of query aligns to 1:305/335 of 3ttnA
7oywA E.Coli's putrescine receptor variant potf/d (4jdf) with mutations e39d f88l s247d in complex with spermidine (see paper)
38% identity, 84% coverage: 28:320/348 of query aligns to 3:313/348 of 7oywA
Sites not aligning to the query:
7oyxB E.Coli's putrescine receptor variant potf/d (4jdf) with mutations e39d y87s f88y s247d in complex with spermidine (see paper)
38% identity, 84% coverage: 28:320/348 of query aligns to 3:313/347 of 7oyxB
Sites not aligning to the query:
7oyvA E.Coli's putrescine receptor variant potf/d (4jdf) with mutations e39d f88a s247d in complex with spermidine (see paper)
38% identity, 84% coverage: 28:320/348 of query aligns to 3:313/341 of 7oyvA
Sites not aligning to the query:
P31133 Putrescine-binding periplasmic protein PotF from Escherichia coli (strain K12) (see 3 papers)
36% identity, 92% coverage: 2:320/348 of query aligns to 6:341/370 of P31133
Sites not aligning to the query:
6ye7A E.Coli's putrescine receptor potf complexed with cadaverine (see paper)
36% identity, 84% coverage: 28:320/348 of query aligns to 3:313/341 of 6ye7A
6ye6A E.Coli's putrescine receptor potf complexed with agmatine (see paper)
36% identity, 84% coverage: 28:320/348 of query aligns to 3:313/341 of 6ye6A
Sites not aligning to the query:
6ye0B E.Coli's putrescine receptor potf complexed with putrescine (see paper)
36% identity, 84% coverage: 28:320/348 of query aligns to 3:313/341 of 6ye0B
Sites not aligning to the query:
1a99A Putrescine receptor (potf) from e. Coli (see paper)
36% identity, 84% coverage: 28:320/348 of query aligns to 3:313/341 of 1a99A
4euoA Structure of atu4243-gaba sensor (see paper)
28% identity, 80% coverage: 44:320/348 of query aligns to 21:285/313 of 4euoA
Sites not aligning to the query:
6hlyA Structure in p212121 form of the pbp agtb in complex with agropinic acid from a.Tumefacien r10 (see paper)
25% identity, 82% coverage: 43:329/348 of query aligns to 24:301/320 of 6hlyA
Sites not aligning to the query:
4r75A Structure of the periplasmic binding protein afua from actinobacillus pleuropneumoniae (exogenous sedoheptulose-7-phosphate bound) (see paper)
23% identity, 42% coverage: 133:279/348 of query aligns to 101:253/318 of 4r75A
Sites not aligning to the query:
4r74A Structure of the periplasmic binding protein afua from actinobacillus pleuropneumoniae (exogenous fructose-6-phosphate bound) (see paper)
23% identity, 42% coverage: 133:279/348 of query aligns to 102:254/319 of 4r74A
Sites not aligning to the query:
>15245 FitnessBrowser__Keio:15245
MKKWSRHLLAAGALALGMSAAHADDNNTLYFYNWTEYVPPGLLEQFTKETGIKVIYSTYE
SNETMYAKLKTYKDGAYDLVVPSTYYVDKMRKEGMIQKIDKSKLTNFSNLDPDMLNKPFD
PNNDYSIPYIWGATAIGVNGDAVDPKSVTSWADLWKPEYKGSLLLTDDAREVFQMALRKL
GYSGNTTDPKEIEAAYNELKKLMPNVAAFNSDNPANPYMEGEVNLGMIWNGSAFVARQAG
TPIDVVWPKEGGIFWMDSLAIPANAKNKEGALKLINFLLRPDVAKQVAETIGYPTPNLAA
RKLLSPEVANDKTLYPDAETIKNGEWQNDVGAASSIYEEYYQKLKAGR
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory