Comparing 15302 b1180 predicted isomerase/hydrolase (NCBI) to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 19 hits to proteins with known functional sites (download)
3v77A Crystal structure of a putative fumarylacetoacetate isomerase/hydrolase from oleispira antarctica (see paper)
50% identity, 94% coverage: 14:219/219 of query aligns to 11:216/224 of 3v77A
6sbiA X-ray structure of murine fumarylacetoacetate hydrolase domain containing protein 1 (fahd1) in complex with inhibitor oxalate (see paper)
49% identity, 88% coverage: 19:211/219 of query aligns to 14:205/216 of 6sbiA
Q6P587 Acylpyruvase FAHD1, mitochondrial; Fumarylacetoacetate hydrolase domain-containing protein 1; FAH domain-containing protein 1; Oxaloacetate decarboxylase; OAA decarboxylase; YisK-like protein; EC 3.7.1.5; EC 4.1.1.112 from Homo sapiens (Human) (see 3 papers)
47% identity, 91% coverage: 19:218/219 of query aligns to 20:219/224 of Q6P587
6fogA X-ray structure of homo sapiens fumarylacetoacetate hydrolase domain containing protein 1 (fahd1) in complex with inhibitor oxalate at 1.94a resolution. (see paper)
47% identity, 91% coverage: 19:218/219 of query aligns to 15:214/218 of 6fogA
Sites not aligning to the query:
6j5yA Crystal structure of fumarylpyruvate hydrolase from pseudomonas aeruginosa in complex with mn2+ and pyruvate (see paper)
40% identity, 94% coverage: 14:219/219 of query aligns to 21:231/233 of 6j5yA
1nkqA Crystal structure of yeast ynq8, a fumarylacetoacetate hydrolase family protein
36% identity, 86% coverage: 18:205/219 of query aligns to 10:218/247 of 1nkqA
3qdfA Crystal structure of 2-hydroxyhepta-2,4-diene-1,7-dioate isomerase from mycobacterium marinum (see paper)
37% identity, 89% coverage: 17:211/219 of query aligns to 62:239/252 of 3qdfA
8gstC Crystal structure of l-2,4-diketo-3-deoxyrhamnonate hydrolase from sphingomonas sp. (Pyruvate bound-form) (see paper)
37% identity, 83% coverage: 16:197/219 of query aligns to 70:248/290 of 8gstC
8gsrA Crystal structure of l-2,4-diketo-3-deoxyrhamnonate hydrolase from sphingomonas sp. (Apo-form) (see paper)
37% identity, 83% coverage: 16:197/219 of query aligns to 70:248/290 of 8gsrA
1gttA Crystal structure of hpce (see paper)
38% identity, 84% coverage: 12:196/219 of query aligns to 218:391/421 of 1gttA
6iymA Fumarylacetoacetate hydrolase (eafah) from psychrophilic exiguobacterium antarcticum (see paper)
37% identity, 90% coverage: 15:211/219 of query aligns to 67:266/277 of 6iymA
8sutA Crystal structure of yisk from bacillus subtilis in complex with reaction product 4-hydroxy-2-oxoglutaric acid (see paper)
34% identity, 89% coverage: 15:210/219 of query aligns to 91:292/303 of 8sutA
8skyB Crystal structure of yisk from bacillus subtilis in complex with oxalate (see paper)
34% identity, 89% coverage: 15:210/219 of query aligns to 90:291/303 of 8skyB
6jvwB Crystal structure of maleylpyruvate hydrolase from sphingobium sp. Syk-6 in complex with manganese (ii) ion and pyruvate (see paper)
33% identity, 93% coverage: 7:210/219 of query aligns to 75:251/264 of 6jvwB
6j5xB Crystal structure of fumarylpyruvate hydrolase from corynebacterium glutamicum in complex with mn2+ and pyruvate (see paper)
37% identity, 82% coverage: 18:197/219 of query aligns to 69:247/280 of 6j5xB
6j5xA Crystal structure of fumarylpyruvate hydrolase from corynebacterium glutamicum in complex with mn2+ and pyruvate (see paper)
37% identity, 82% coverage: 18:197/219 of query aligns to 69:247/280 of 6j5xA
6v77B Crystal structure of a putative hpce protein from mycobacterium smegmatis
34% identity, 89% coverage: 18:211/219 of query aligns to 71:267/279 of 6v77B
4dbhA Crystal structure of cg1458 with inhibitor (see paper)
32% identity, 89% coverage: 17:211/219 of query aligns to 62:258/269 of 4dbhA
3r6oA Crystal structure of a probable 2-hydroxyhepta-2,4-diene-1, 7- dioateisomerase from mycobacterium abscessus (see paper)
30% identity, 82% coverage: 18:197/219 of query aligns to 64:231/265 of 3r6oA
>15302 b1180 predicted isomerase/hydrolase (NCBI)
MYQHHNWQGALLDYPVSKVVCVGSNYAKHIKEMGSAVPEEPVLFIKPETALCDLRQPLAI
PSDFGSVHHEVELAVLIGATLRQATEEHVRKAIAGYGVALDLTLRDVQGKMKKAGQPWEK
AKAFDNSCPLSGFIPAAEFTGDPQNTTLSLSVNGEQRQQGTTADMIHKIVPLIAYMSKFF
TLKAGDVVLTGTPDGVGPLQSGDELTVTFDGHSLTTRVL
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory