SitesBLAST
Comparing 15311 FitnessBrowser__Keio:15311 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
7cyxA Crystal strcuture of glycine oxidase from bacillus cereus atcc 14579 (see paper)
24% identity, 92% coverage: 3:401/432 of query aligns to 4:347/363 of 7cyxA
- binding flavin-adenine dinucleotide: I7 (≠ L6), G8 (= G7), G10 (= G9), V11 (= V10), I12 (≠ V11), V30 (≠ I29), E31 (≠ D30), K32 (≠ R31), E38 (= E38), A39 (≠ T39), S40 (= S40), A43 (≠ N43), G45 (= G45), L46 (≠ Q46), V171 (= V224), G200 (≠ F253), G201 (= G254), W203 (≠ Y256), G298 (= G353), R300 (= R355), P301 (= P356), Y326 (≠ G380), R327 (≠ T381), N328 (≠ L382), G329 (= G383), I330 (≠ W384)
Q8GAI3 4-methylaminobutanoate oxidase (formaldehyde-forming); MABO; Demethylating gamma-N-methylaminobutyrate oxidase; Gamma-N-methylaminobutyrate oxidase 1; EC 1.5.3.19 from Paenarthrobacter nicotinovorans (Arthrobacter nicotinovorans) (see paper)
24% identity, 96% coverage: 1:416/432 of query aligns to 26:401/824 of Q8GAI3
- W66 (= W55) mutation W->F,S: Contains a non-covalently bound FAD. Loss of enzyme activity.
- H67 (≠ A56) mutation to A: Contains a non-covalently bound FAD. Exhibits about 10% of the wild-type enzyme activity.
1y56B Crystal structure of l-proline dehydrogenase from p.Horikoshii (see paper)
24% identity, 72% coverage: 109:418/432 of query aligns to 60:371/374 of 1y56B
- active site: H224 (≠ G274), P239 (= P288), G305 (= G353), M338 (≠ T385)
- binding flavin-adenine dinucleotide: E170 (≠ P223), V171 (= V224), T200 (≠ F253), N201 (≠ G254), W203 (≠ Y256), G305 (= G353), Y306 (≠ L354), Y307 (≠ R355), G334 (≠ T381), H335 (≠ L382), G336 (= G383), F337 (≠ W384), M338 (≠ T385)
- binding flavin mononucleotide: I260 (≠ G311), R301 (≠ T349), W303 (= W351)
Sites not aligning to the query:
- active site: 44, 47, 48
- binding flavin-adenine dinucleotide: 11, 13, 14, 15, 33, 34, 35, 42, 43, 45, 46, 47, 49
- binding flavin mononucleotide: 44, 45
4yshB Crystal structure of glycine oxidase from geobacillus kaustophilus
25% identity, 71% coverage: 108:415/432 of query aligns to 61:368/368 of 4yshB
- active site: I262 (≠ V310), L283 (= L338), G305 (= G353), N335 (≠ L382), L338 (≠ T385)
- binding flavin-adenine dinucleotide: V178 (= V224), S206 (≠ F253), W209 (≠ Y256), R307 (= R355), H332 (= H379), R334 (≠ T381), N335 (≠ L382), G336 (= G383), I337 (≠ W384), L338 (≠ T385)
- binding glycine: G249 (≠ Y297), Y251 (≠ I299), Y251 (≠ I299), A264 (≠ G312), R307 (= R355), R334 (≠ T381), R334 (≠ T381)
Sites not aligning to the query:
- active site: 45, 48, 49, 52
- binding flavin-adenine dinucleotide: 9, 10, 12, 14, 32, 33, 34, 40, 41, 42, 45, 46, 48
S5FMM4 Glycine oxidase; GO; BliGO; EC 1.4.3.19 from Bacillus licheniformis (see paper)
24% identity, 69% coverage: 103:400/432 of query aligns to 57:348/369 of S5FMM4
- K81 (vs. gap) mutation to R: Shows 7.1- and 8-fold increase of affinity and catalytic efficiency to glyphosate, respectively, while the substrate affinity to glycine decreases 235-fold and catalytic efficiency decreases 113-fold; when associated with S-51, R-54, C-202, V-332 and V-342.
- S202 (≠ F253) mutation to C: Shows 7.1- and 8-fold increase of affinity and catalytic efficiency to glyphosate, respectively, while the substrate affinity to glycine decreases 235-fold and catalytic efficiency decreases 113-fold; when associated with S-51, R-54, R-81, V-332 and V-342.
- I332 (≠ W384) mutation to V: Shows 7.1- and 8-fold increase of affinity and catalytic efficiency to glyphosate, respectively, while the substrate affinity to glycine decreases 235-fold and catalytic efficiency decreases 113-fold; when associated with S-51, R-54, R-81, C-202 and V-342.
- M342 (≠ L394) mutation to V: Shows 7.1- and 8-fold increase of affinity and catalytic efficiency to glyphosate, respectively, while the substrate affinity to glycine decreases 235-fold and catalytic efficiency decreases 113-fold; when associated with S-51, R-54, R-81, C-202 and V-332.
Sites not aligning to the query:
- 51 G→S: Shows 4.3- and 107-fold increase of affinity to glyphosate and glycine, respectively. Shows 7.1- and 8-fold increase of affinity and catalytic efficiency to glyphosate, respectively, while the substrate affinity to glycine decreases 235-fold and catalytic efficiency decreases 113-fold; when associated with R-54, R-81, C-202, V-332 and V-342.
- 54 A→R: Shows 7.1- and 8-fold increase of affinity and catalytic efficiency to glyphosate, respectively, while the substrate affinity to glycine decreases 235-fold and catalytic efficiency decreases 113-fold; when associated with S-51, R-81, C-202, V-332 and V-342.
4yshA Crystal structure of glycine oxidase from geobacillus kaustophilus
25% identity, 71% coverage: 108:415/432 of query aligns to 61:368/370 of 4yshA
- active site: I262 (≠ V310), L283 (= L338), G305 (= G353), N335 (≠ L382), L338 (≠ T385)
- binding flavin-adenine dinucleotide: V178 (= V224), S206 (≠ F253), G207 (= G254), W209 (≠ Y256), R307 (= R355), H332 (= H379), R334 (≠ T381), N335 (≠ L382), G336 (= G383), I337 (≠ W384)
Sites not aligning to the query:
- active site: 45, 48, 49, 52
- binding flavin-adenine dinucleotide: 10, 12, 14, 32, 33, 34, 40, 41, 42, 45, 46, 47, 48
Q5L2C2 Glycine oxidase; GO; GOX; GOXK; EC 1.4.3.19 from Geobacillus kaustophilus (strain HTA426)
25% identity, 71% coverage: 108:415/432 of query aligns to 62:370/377 of Q5L2C2
- V180 (= V224) binding
- R309 (= R355) binding
- 334:340 (vs. 379:385, 29% identical) binding
- R336 (≠ T381) binding
Sites not aligning to the query:
- 14:15 binding
- 34:35 binding
- 42:43 binding
- 47:49 binding
2gagB Heteroteterameric sarcosine: structure of a diflavin metaloenzyme at 1.85 a resolution (see paper)
22% identity, 66% coverage: 134:418/432 of query aligns to 102:390/403 of 2gagB
- binding flavin-adenine dinucleotide: V195 (= V224), G224 (≠ F253), A225 (≠ G254), H227 (≠ Y256), L231 (≠ M260), L246 (≠ D285), G352 (= G380), T353 (= T381), G354 (≠ L382), G355 (= G383), F356 (≠ W384), K357 (≠ T385)
- binding flavin mononucleotide: H171 (≠ C200), V250 (= V289), E278 (≠ G312), R321 (≠ T349), W323 (= W351)
- binding 2-furoic acid: M263 (≠ F304), Y270 (vs. gap), K357 (≠ T385)
- binding sulfite ion: K170 (≠ D199), K276 (vs. gap)
Sites not aligning to the query:
- active site: 61, 64, 65
- binding flavin-adenine dinucleotide: 26, 28, 29, 30, 51, 52, 58, 59, 60, 62, 63, 64, 66
- binding flavin mononucleotide: 61, 62
- binding 2-furoic acid: 64, 66, 68, 401
P40875 Sarcosine oxidase subunit beta; Sarcosine oxidase subunit B; Sarcosine oxidase (5,10-methylenetetrahydrofolate-forming) subunit beta; Tetrameric sarcosine oxidase subunit beta; TSOX subunit beta; EC 1.5.3.24 from Corynebacterium sp. (strain P-1) (see 3 papers)
22% identity, 74% coverage: 111:431/432 of query aligns to 81:405/405 of P40875
- C146 (≠ E176) mutation to S: No change in activity.
- H173 (≠ C200) modified: Tele-8alpha-FMN histidine; mutation to N: Prevents covalent attachment of FMN. Loss of activity. The mutant is considerably less stable than wild-type enzyme, the beta and delta subunits are lost during purification, which yields a stable alpha-gamma complex.
- H175 (≠ L202) mutation to A: No effect on FMN binding and activity.
- C195 (≠ T222) mutation to S: No change in activity.
- C351 (≠ T377) mutation to A: No change in activity.
Sites not aligning to the query:
- 1 modified: Initiator methionine, Removed
- 30 G→A: Prevents covalent attachment of FMN. Blocks subunit assembly.
6j39A Crystal structure of cmis2 with inhibitor (see paper)
25% identity, 91% coverage: 11:405/432 of query aligns to 11:359/368 of 6j39A
- binding (3R)-3-[(carboxymethyl)sulfanyl]nonanoic acid: M44 (≠ Y51), P46 (≠ D80), N49 (≠ Q83), R243 (≠ S290), Y252 (≠ I299), Y267 (≠ A314), R308 (= R355), R334 (≠ T381), I335 (≠ L382)
- binding flavin-adenine dinucleotide: I11 (≠ V11), V29 (≠ I29), D30 (= D30), P31 (≠ R31), E32 (= E32), K36 (≠ N43), A37 (= A44), S38 (≠ G45), V40 (≠ I47), S41 (= S48), A42 (≠ P49), G43 (= G50), M44 (≠ Y51), A174 (≠ T222), A203 (≠ F253), W206 (≠ Y256), I228 (≠ S276), Y252 (≠ I299), R308 (= R355), S333 (≠ G380), R334 (≠ T381), I335 (≠ L382), G336 (= G383), V337 (≠ W384), Q338 (≠ T385)
Sites not aligning to the query:
6j38A Crystal structure of cmis2 (see paper)
25% identity, 91% coverage: 11:405/432 of query aligns to 11:359/368 of 6j38A
- binding flavin-adenine dinucleotide: I11 (≠ V11), V29 (≠ I29), D30 (= D30), P31 (≠ R31), K36 (≠ N43), A37 (= A44), S38 (≠ G45), S41 (= S48), A42 (≠ P49), G43 (= G50), M44 (≠ Y51), A174 (≠ T222), A203 (≠ F253), W206 (≠ Y256), G226 (= G274), G306 (= G353), R308 (= R355), S333 (≠ G380), R334 (≠ T381), I335 (≠ L382), G336 (= G383), V337 (≠ W384), Q338 (≠ T385)
Sites not aligning to the query:
Q50LF2 Sarcosine oxidase subunit beta; Sarcosine oxidase subunit B; Sarcosine oxidase (5,10-methylenetetrahydrofolate-forming) subunit beta; Tetrameric sarcosine oxidase subunit beta; TSOX subunit beta; EC 1.5.3.24 from Corynebacterium sp. (strain U-96) (see 4 papers)
22% identity, 66% coverage: 134:418/432 of query aligns to 104:392/405 of Q50LF2
- K172 (≠ D199) mutation to A: Retains 39% of wild-type activity.; mutation to D: Retains 32% of wild-type activity.; mutation to R: Retains 58% of wild-type activity.
- H173 (≠ C200) modified: Tele-8alpha-FMN histidine
- V197 (= V224) binding
- H270 (≠ R309) mutation to A: 10-fold decrease in catalytic efficiency.
- Y272 (vs. gap) mutation to A: 13000-fold decrease in catalytic efficiency.; mutation to F: 130-fold decrease in catalytic efficiency.
- G354 (= G380) binding
- G357 (= G383) binding
- K359 (≠ T385) binding ; mutation K->A,D: Loss of activity.; mutation to R: Retains 0.07% of wild-type activity. Shows higher apparent KM for sarcosine.
Sites not aligning to the query:
- 31 binding
- 32 binding
- 53 binding
- 61 binding
- 62 binding
- 66 binding
- 68 binding
Q9AGP8 Dimethylglycine oxidase; DMGO; EC 1.5.3.10 from Arthrobacter globiformis (see 2 papers)
24% identity, 61% coverage: 108:369/432 of query aligns to 62:349/830 of Q9AGP8
- V174 (= V224) binding
- H225 (≠ K273) Important for catalytic activity; mutation to Q: Reduces catalytic efficiency 3-fold and substrate affinity 30-fold.
- Y259 (≠ A300) Important for catalytic activity; binding ; mutation to F: Reduces catalytic efficiency 225-fold and substrate affinity 25-fold.
Sites not aligning to the query:
- 14:15 binding
- 35:36 binding
- 45:48 binding
- 52 binding
- 360:363 binding
- 539 binding
- 552 Important for catalytic activity; D→A: No effect on the activity.; D→N: Reduces activity 3-fold.
1vrqB Crystal structure of heterotetrameric sarcosine oxidase from corynebacterium sp. U-96 in complex with folinic acid (see paper)
22% identity, 66% coverage: 134:418/432 of query aligns to 103:391/402 of 1vrqB
- active site: G326 (= G353), K358 (≠ T385)
- binding n,n-dimethylglycine: K358 (≠ T385)
- binding flavin-adenine dinucleotide: V196 (= V224), A224 (= A252), G225 (≠ F253), H228 (≠ Y256), L247 (≠ D285), G353 (= G380), T354 (= T381), G355 (≠ L382), G356 (= G383), F357 (≠ W384), K358 (≠ T385)
- binding flavin mononucleotide: H172 (≠ C200), V251 (= V289), E279 (≠ G312), R322 (≠ T349), W324 (= W351)
Sites not aligning to the query:
- active site: 62, 65, 66
- binding n,n-dimethylglycine: 65, 67, 69, 401
- binding flavin-adenine dinucleotide: 26, 27, 29, 30, 31, 51, 52, 53, 59, 60, 61, 63, 64, 65, 67
- binding flavin mononucleotide: 62, 63
3ad8B Heterotetrameric sarcosine oxidase from corynebacterium sp. U-96 in complex with pyrrole 2-carboxylate (see paper)
22% identity, 66% coverage: 134:418/432 of query aligns to 103:391/404 of 3ad8B
- active site: G326 (= G353), K358 (≠ T385)
- binding flavin-adenine dinucleotide: V196 (= V224), G225 (≠ F253), A226 (≠ G254), H228 (≠ Y256), L247 (≠ D285), G353 (= G380), T354 (= T381), G355 (≠ L382), G356 (= G383), F357 (≠ W384), K358 (≠ T385)
- binding flavin mononucleotide: H172 (≠ C200), V251 (= V289), E279 (≠ G312), R322 (≠ T349), W324 (= W351)
- binding pyrrole-2-carboxylate: M264 (≠ F304), Y271 (vs. gap), T354 (= T381), K358 (≠ T385)
Sites not aligning to the query:
- active site: 62, 65, 66
- binding flavin-adenine dinucleotide: 26, 27, 29, 30, 31, 52, 53, 59, 60, 61, 63, 64, 65, 67
- binding flavin mononucleotide: 62, 63
- binding pyrrole-2-carboxylate: 65, 67, 69, 402
3ad7B Heterotetrameric sarcosine oxidase from corynebacterium sp. U-96 in complex with methylthio acetate (see paper)
22% identity, 66% coverage: 134:418/432 of query aligns to 103:391/404 of 3ad7B
- active site: G326 (= G353), K358 (≠ T385)
- binding flavin-adenine dinucleotide: V196 (= V224), G225 (≠ F253), A226 (≠ G254), H228 (≠ Y256), L247 (≠ D285), G353 (= G380), T354 (= T381), G355 (≠ L382), G356 (= G383), F357 (≠ W384), K358 (≠ T385)
- binding flavin mononucleotide: H172 (≠ C200), V251 (= V289), K277 (vs. gap), E279 (≠ G312), R322 (≠ T349), W324 (= W351)
- binding [methylthio]acetate: M264 (≠ F304), Y271 (vs. gap), T354 (= T381), K358 (≠ T385)
Sites not aligning to the query:
- active site: 62, 65, 66
- binding flavin-adenine dinucleotide: 26, 27, 29, 30, 31, 52, 53, 59, 60, 61, 63, 64, 65, 67
- binding flavin mononucleotide: 62, 63
- binding [methylthio]acetate: 67, 69, 402
1pj6A Crystal structure of dimethylglycine oxidase of arthrobacter globiformis in complex with folic acid (see paper)
24% identity, 61% coverage: 108:369/432 of query aligns to 60:347/828 of 1pj6A
Sites not aligning to the query:
- active site: 550
- binding flavin-adenine dinucleotide: 9, 11, 12, 13, 33, 34, 42, 43, 44, 46, 48, 50, 358, 359, 360, 361
3gsiA Crystal structure of d552a dimethylglycine oxidase mutant of arthrobacter globiformis in complex with tetrahydrofolate (see paper)
24% identity, 61% coverage: 108:369/432 of query aligns to 59:346/827 of 3gsiA
- active site: H222 (≠ K273), Y256 (≠ A300)
- binding flavin-adenine dinucleotide: T170 (≠ P223), V171 (= V224), A200 (≠ F253), G201 (= G254), W203 (≠ Y256), H222 (≠ K273), Y256 (≠ A300), G330 (= G353), I331 (≠ L354), F332 (≠ R355)
- binding magnesium ion: D254 (≠ K298)
Sites not aligning to the query:
- active site: 549
- binding flavin-adenine dinucleotide: 10, 11, 12, 32, 33, 41, 42, 43, 45, 47, 49, 357, 358, 359, 360
- binding magnesium ion: 409
- binding (6s)-5,6,7,8-tetrahydrofolate: 505, 536, 551, 563, 629, 648, 655, 696
1pj7A Structure of dimethylglycine oxidase of arthrobacter globiformis in complex with folinic acid (see paper)
24% identity, 61% coverage: 108:369/432 of query aligns to 59:346/827 of 1pj7A
Sites not aligning to the query:
- active site: 549
- binding flavin-adenine dinucleotide: 8, 10, 11, 12, 32, 33, 41, 42, 43, 45, 47, 49, 357, 358, 359, 360
- binding N-[4-({[(6S)-2-amino-5-formyl-4-oxo-3,4,5,6,7,8-hexahydropteridin-6-yl]methyl}amino)benzoyl]-L-glutamic acid: 505, 536, 549, 551, 563, 629, 648, 655, 696
O31616 Glycine oxidase; GO; EC 1.4.3.19 from Bacillus subtilis (strain 168) (see 3 papers)
25% identity, 45% coverage: 209:401/432 of query aligns to 159:349/369 of O31616
- V174 (= V224) binding
- H244 (≠ Y297) mutation to A: 2-fold decrease in catalytic efficiency on glycine and similar catalytic efficiency on glyphosate. 60-fold decrease in catalytic efficiency on glycine and 210-fold increase in that on glyphosate; when associated with S-51 and R-54.
- R302 (= R355) binding
- 327:333 (vs. 379:385, 29% identical) binding
- R329 (≠ T381) binding
Sites not aligning to the query:
- 14:15 binding
- 34:35 binding
- 42:43 binding
- 47:49 binding
- 51 G→R: 130-fold decrease in catalytic efficiency on glycine and 28-fold increase in that on glyphosate.; G→S: 60-fold decrease in catalytic efficiency on glycine and 210-fold increase in that on glyphosate; when associated with R-54 and A-244.
- 54 A→R: 20-fold decrease in catalytic efficiency on glycine and 34-fold increase in that on glyphosate. 60-fold decrease in catalytic efficiency on glycine and 210-fold increase in that on glyphosate; when associated with S-51 and A-244.
Query Sequence
>15311 FitnessBrowser__Keio:15311
MRVVILGSGVVGVASAWYLNQAGHEVTVIDREPGAALETSAANAGQISPGYAAPWAAPGV
PLKAIKWMFQRHAPLAVRLDGTQFQLKWMWQMLRNCDTSHYMENKGRMVRLAEYSRDCLK
ALRAETNIQYEGRQGGTLQLFRTEQQYENATRDIAVLEDAGVPYQLLESSRLAEVEPALA
EVAHKLTGGLQLPNDETGDCQLFTQNLARMAEQAGVKFRFNTPVDQLLCDGEQIYGVKCG
DEVIKADAYVMAFGSYSTAMLKGIVDIPVYPLKGYSLTIPIAQEDGAPVSTILDETYKIA
ITRFDNRIRVGGMAEIVGFNTELLQPRRETLEMVVRDLYPRGGHVEQATFWTGLRPMTPD
GTPVVGRTRFKNLWLNTGHGTLGWTMACGSGQLLSDLLSGRTPAIPYEDLSVARYSRGFT
PSRPGHLHGAHS
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory