Comparing 15320 FitnessBrowser__Keio:15320 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 11 hits to proteins with known functional sites (download)
P37349 PEP-dependent dihydroxyacetone kinase, phosphoryl donor subunit DhaM; Dihydroxyacetone kinase subunit M; EC 2.7.1.121 from Escherichia coli (strain K12) (see paper)
100% identity, 100% coverage: 1:472/472 of query aligns to 1:472/472 of P37349
2wqdA Crystal structure of enzyme i of the phosphoenolpyruvate:sugar phosphotransferase system in the dephosphorylated state (see paper)
28% identity, 38% coverage: 264:444/472 of query aligns to 23:204/570 of 2wqdA
Sites not aligning to the query:
P23533 Phosphoenolpyruvate-protein phosphotransferase; Phosphotransferase system, enzyme I; EC 2.7.3.9 from Staphylococcus carnosus (strain TM300) (see paper)
26% identity, 39% coverage: 284:465/472 of query aligns to 43:225/573 of P23533
Sites not aligning to the query:
P08839 Phosphoenolpyruvate-protein phosphotransferase; Phosphotransferase system, enzyme I; EC 2.7.3.9 from Escherichia coli (strain K12) (see 2 papers)
33% identity, 35% coverage: 296:462/472 of query aligns to 54:221/575 of P08839
Sites not aligning to the query:
2hwgA Structure of phosphorylated enzyme i of the phosphoenolpyruvate:sugar phosphotransferase system (see paper)
33% identity, 35% coverage: 296:462/472 of query aligns to 53:220/572 of 2hwgA
Sites not aligning to the query:
Q9F166 Phosphocarrier protein HPr from Bacillus thuringiensis subsp. israelensis (see 2 papers)
36% identity, 17% coverage: 162:241/472 of query aligns to 7:87/87 of Q9F166
O69250 Phosphocarrier protein HPr; Histidine-containing protein from Priestia megaterium (Bacillus megaterium) (see 2 papers)
35% identity, 16% coverage: 166:241/472 of query aligns to 12:88/88 of O69250
P24366 Phosphocarrier protein HPr; Histidine-containing protein from Streptococcus salivarius (see paper)
35% identity, 15% coverage: 162:233/472 of query aligns to 8:79/87 of P24366
O06976 HPr-like protein Crh; Catabolite repression HPr from Bacillus subtilis (strain 168) (see 3 papers)
38% identity, 15% coverage: 160:228/472 of query aligns to 6:74/85 of O06976
P08877 Phosphocarrier protein HPr; Histidine-containing protein from Bacillus subtilis (strain 168) (see 5 papers)
35% identity, 16% coverage: 166:241/472 of query aligns to 12:88/88 of P08877
Sites not aligning to the query:
Q9CJ83 Phosphocarrier protein HPr; Histidine-containing protein from Lactococcus lactis subsp. lactis (strain IL1403) (Streptococcus lactis) (see paper)
37% identity, 13% coverage: 166:228/472 of query aligns to 12:74/88 of Q9CJ83
>15320 FitnessBrowser__Keio:15320
MVNLVIVSHSSRLGEGVGELARQMLMSDSCKIAIAAGIDDPQNPIGTDAVKVMEAIESVA
DADHVLVMMDMGSALLSAETALELLAPEIAAKVRLCAAPLVEGTLAATVSAASGADIDKV
IFDAMHALEAKREQLGLPSSDTEISDTCPAYDEEARSLAVVIKNRNGLHVRPASRLVYTL
STFNADMLLEKNGKCVTPESINQIALLQVRYNDTLRLIAKGPEAEEALIAFRQLAEDNFG
ETEEVAPPTLRPVPPVSGKAFYYQPVLCTVQAKSTLTVEEEQDRLRQAIDFTLLDLMTLT
AKAEASGLDDIAAIFSGHHTLLDDPELLAAASELLQHEHCTAEYAWQQVLKELSQQYQQL
DDEYLQARYIDVDDLLHRTLVHLTQTKEELPQFNSPTILLAENIYPSTVLQLDPAVVKGI
CLSAGSPVSHSALIARELGIGWICQQGEKLYAIQPEETLTLDVKTQRFNRQG
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory