SitesBLAST
Comparing 15328 FitnessBrowser__Keio:15328 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
3ny7A Stas domain of ychm bound to acp (see paper)
98% identity, 21% coverage: 443:559/559 of query aligns to 2:118/118 of 3ny7A
5da0A Structure of the the slc26 transporter slc26dg in complex with a nanobody (see paper)
28% identity, 90% coverage: 21:525/559 of query aligns to 2:457/467 of 5da0A
7lhvA Structure of arabidopsis thaliana sulfate transporter atsultr4;1 (see paper)
28% identity, 96% coverage: 12:549/559 of query aligns to 14:563/575 of 7lhvA
- binding 1-palmitoyl-2-oleoyl-sn-glycero-3-phosphocholine: L126 (≠ A122), R127 (= R123), W130 (≠ R126)
- binding (2S,3R,4E)-2-amino-3-hydroxyoctadec-4-en-1-yl dihydrogen phosphate: L128 (≠ F124), L131 (= L127), E409 (≠ V424), L413 (≠ S428), G417 (≠ V432), A421 (≠ L437)
- binding sulfate ion: A84 (= A87), S321 (≠ A335), F322 (≠ I336)
Q55415 Bicarbonate transporter BicA from Synechocystis sp. (strain PCC 6803 / Kazusa) (see paper)
27% identity, 94% coverage: 32:558/559 of query aligns to 15:541/564 of Q55415
- T69 (= T86) binding ; mutation to A: Alters bicarbonate transport.
- D258 (≠ E292) binding ; mutation D->A,E: Alters bicarbonate transport.
- T262 (≠ C296) binding ; mutation to A: Alters bicarbonate transport.
- G300 (≠ A334) binding
- A301 (= A335) binding
- T302 (≠ I336) binding ; mutation to A: Alters bicarbonate transport.
- A471 (≠ R488) mutation to N: Alters bicarbonate transport.
- L476 (≠ K493) mutation to S: Alters bicarbonate transport.
- A486 (≠ G504) mutation to E: Alters bicarbonate transport.
- L490 (≠ F508) mutation to Q: Alters bicarbonate transport.
6ki1B The transmembrane domain of a cyanobacterium bicarbonate transporter bica (see paper)
29% identity, 71% coverage: 32:427/559 of query aligns to 14:391/392 of 6ki1B
7v74A Thermostabilized human prestin in complex with sulfate (see paper)
26% identity, 93% coverage: 20:538/559 of query aligns to 13:566/597 of 7v74A
7v75A Thermostabilized human prestin in complex with salicylate (see paper)
25% identity, 93% coverage: 20:538/559 of query aligns to 13:574/605 of 7v75A
Q9URY8 Probable sulfate permease C869.05c from Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast) (see paper)
26% identity, 68% coverage: 20:400/559 of query aligns to 112:487/840 of Q9URY8
Sites not aligning to the query:
- 823 modified: Phosphoserine
7xulA Human slc26a3 in complex with tenidap
24% identity, 81% coverage: 18:471/559 of query aligns to 47:516/690 of 7xulA
- binding 5-chloranyl-2-oxidanyl-3-thiophen-2-ylcarbonyl-indole-1-carboxamide: V72 (≠ I42), L75 (≠ P45), Q76 (≠ L46), E262 (≠ C217), S367 (≠ A337), L412 (= L382), N416 (≠ V386)
- binding cholesterol hemisuccinate: I157 (= I114), F162 (≠ M119), P209 (= P164), K214 (≠ Q169), Y217 (≠ G172), V302 (≠ S266), Q306 (≠ T269), V309 (≠ W272), V450 (≠ L420)
7xujA Human slc26a3 in complex with uk5099
24% identity, 81% coverage: 18:471/559 of query aligns to 54:525/703 of 7xujA
- binding (E)-2-cyano-3-(1-phenylindol-3-yl)prop-2-enoic acid: V79 (≠ I42), Q83 (≠ L46), E271 (≠ C217), S376 (≠ A337), R377 (= R338), V380 (≠ A341), L421 (= L382), A422 (≠ L383), N425 (≠ V386)
- binding cholesterol hemisuccinate: F171 (≠ M119), V311 (≠ S266), Q315 (≠ T269)
7xuhA Down-regulated in adenoma in complex with tqr1122
24% identity, 81% coverage: 18:471/559 of query aligns to 54:529/707 of 7xuhA
- binding 2-[4,8-dimethyl-2-oxidanylidene-7-[[3-(trifluoromethyl)phenyl]methoxy]chromen-3-yl]ethanoic acid: P124 (vs. gap), I125 (vs. gap), L187 (≠ I131), I192 (≠ T136), F195 (= F139), V335 (≠ M285), S338 (vs. gap), S380 (≠ A337), M433 (= M390)
- binding cholesterol hemisuccinate: V223 (≠ E165), F226 (≠ L168), K227 (≠ Q169), Y230 (≠ G172), F318 (= F268), Q319 (≠ T269)
Q8CIW6 Solute carrier family 26 member 6; Anion exchange transporter; Chloride-formate exchanger; Pendrin-L1; Pendrin-like protein 1; Putative anion transporter-1; Pat-1 from Mus musculus (Mouse) (see paper)
24% identity, 79% coverage: 39:479/559 of query aligns to 102:560/758 of Q8CIW6
- F552 (= F470) mutation to A: Does not inhibit formate transport in PMA-induced cells.
P40879 Chloride anion exchanger; Down-regulated in adenoma; Protein DRA; Solute carrier family 26 member 3 from Homo sapiens (Human) (see 3 papers)
23% identity, 79% coverage: 32:471/559 of query aligns to 76:547/764 of P40879
- N153 (≠ A88) modified: carbohydrate, N-linked (GlcNAc...) asparagine
- N161 (≠ V96) modified: carbohydrate, N-linked (GlcNAc...) asparagine
- N165 (vs. gap) modified: carbohydrate, N-linked (GlcNAc...) asparagine
- C307 (≠ S235) to W: in dbSNP:rs34407351
Sites not aligning to the query:
- 761:764 PDZ-binding; mutation Missing: Loss of interaction with NHERF4. No effect on localization to cell membrane or its exchanger activity.
8sieC Pendrin in complex with bicarbonate
22% identity, 89% coverage: 20:515/559 of query aligns to 34:564/613 of 8sieC
- binding Lauryl Maltose Neopentyl Glycol: G198 (≠ E165), S296 (≠ T269), T300 (≠ P280), F303 (= F283)
- binding bicarbonate ion: Y65 (≠ L50), F101 (vs. gap), L356 (≠ I336), S357 (≠ A337), V403 (≠ L383), N406 (≠ V386)
- binding cholesterol: L226 (≠ V191), V255 (≠ M220), I262 (≠ G227), Y272 (≠ F237), F411 (vs. gap), V414 (≠ A393), V414 (≠ A393), C415 (≠ H394), C415 (≠ H394), I436 (≠ M415), M452 (≠ V432), F453 (≠ L433)
- binding 1-palmitoyl-2-oleoyl-sn-glycero-3-phosphocholine: W421 (≠ L400), V429 (≠ I408), V432 (≠ M411), F433 (≠ L412), I436 (≠ M415)
8shcC Pendrin in complex with niflumic acid
22% identity, 89% coverage: 20:515/559 of query aligns to 34:564/613 of 8shcC
- binding cholesterol: I199 (vs. gap), A223 (≠ I188), V255 (≠ M220), Y272 (≠ F237), M412 (≠ S391), C415 (≠ H394), M452 (≠ V432), F453 (≠ L433)
- binding 1-palmitoyl-2-oleoyl-sn-glycero-3-phosphocholine: Q156 (≠ R123), W421 (≠ L400), V432 (≠ M411), F433 (≠ L412), F455 (≠ S435)
- binding 2-{[3-(trifluoromethyl)phenyl]amino}nicotinic acid: Y65 (≠ L50), F101 (vs. gap), T173 (= T140), E252 (≠ C217), I312 (vs. gap), L356 (≠ I336), S357 (≠ A337), V402 (≠ L382), N406 (≠ V386)
8sgwC Pendrin in complex with chloride
22% identity, 89% coverage: 20:515/559 of query aligns to 34:564/613 of 8sgwC
- binding Lauryl Maltose Neopentyl Glycol: G198 (≠ E165), S296 (≠ T269), T300 (≠ P280), F303 (= F283)
- binding cholesterol: I228 (≠ L193), V255 (≠ M220), I262 (≠ G227), Y272 (≠ F237), K408 (≠ W388), F411 (vs. gap), M412 (≠ S391), M412 (≠ S391), V414 (≠ A393), C415 (≠ H394), V417 (= V396), I439 (≠ V419)
- binding 1-palmitoyl-2-oleoyl-sn-glycero-3-phosphocholine: F159 (≠ R126), Y163 (= Y130), F284 (≠ V258), P286 (= P260), I289 (≠ L263), F343 (≠ I323), F346 (= F326), W421 (≠ L400), F433 (≠ L412), I436 (≠ M415), F455 (≠ S435), F464 (vs. gap), P465 (vs. gap)
Q9BXS9 Solute carrier family 26 member 6; Anion exchange transporter; Pendrin-like protein 1; Pendrin-L1 from Homo sapiens (Human) (see 3 papers)
23% identity, 80% coverage: 39:483/559 of query aligns to 100:564/759 of Q9BXS9
- N167 (vs. gap) modified: carbohydrate, N-linked (GlcNAc) asparagine; mutation to Q: Reduced chloride oxalate exchanger activity.
- N172 (vs. gap) modified: carbohydrate, N-linked (GlcNAc) asparagine; mutation to Q: Reduced chloride oxalate exchanger activity.
- V206 (≠ L127) to M: in dbSNP:rs13324142
- ATV 547:549 (≠ GPL 466:468) mutation to NVN: Does not inhibit cell membrane localization. Inhibits interaction with CA2 and bicarbonate transport.
- N553 (≠ A472) mutation to A: Does not inhibit interaction with CA2. Inhibits interaction with CA2 and bicarbonate transport in PMA-induced cells.
Sites not aligning to the query:
- 582 S→A: Does not inhibit interaction with CA2. Does not inhibit interaction with CA2 and bicarbonate transport in PMA-induced cells.
Q62273 Sulfate transporter; Diastrophic dysplasia protein homolog; ST-OB; Solute carrier family 26 member 2 from Mus musculus (Mouse) (see paper)
25% identity, 63% coverage: 20:371/559 of query aligns to 98:475/739 of Q62273
- F368 (≠ V258) mutation to A: Reduced sulfate-chloride exchange activity.
- E417 (= E313) mutation E->A,K: Loss of sulfate-chloride exchange activity.
A0FKN5 Prestin; Solute carrier family 26 member 5 from Gallus gallus (Chicken) (see paper)
22% identity, 69% coverage: 2:385/559 of query aligns to 55:452/742 of A0FKN5
- S404 (≠ A337) Controls the anion transport; mutation to A: Alters anion selectivity.; mutation to C: Abolishes sulfate transport. Does not affect oxalate transport. Is accesible both from extracellular and intracellular side by methane-thiosulphonate (MTS) reagents. Inhibits divalent transport upon extracellular application of (2-sulphonatoethyl)methane-thiosulphonate (MTSES) but not [2-(trimethylammonium)ethyl]methane-thiosulphonate (MTSET). Abolishes anion transport upon intracellular MTSET application.
- R405 (= R338) mutation to C: Fully abolishes anion transport.
7lguA Structure of human prestin in the presence of nacl (see paper)
19% identity, 92% coverage: 32:544/559 of query aligns to 71:617/680 of 7lguA
Query Sequence
>15328 FitnessBrowser__Keio:15328
MNKIFSSHVMPFRALIDACWKEKYTAARFTRDLIAGITVGIIAIPLAMALAIGSGVAPQY
GLYTAAVAGIVIALTGGSRFSVSGPTAAFVVILYPVSQQFGLAGLLVATLLSGIFLILMG
LARFGRLIEYIPVSVTLGFTSGIGITIGTMQIKDFLGLQMAHVPEHYLQKVGALFMALPT
INVGDAAIGIVTLGILVFWPRLGIRLPGHLPALLAGCAVMGIVNLLGGHVATIGSQFHYV
LADGSQGNGIPQLLPQLVLPWDLPNSEFTLTWDSIRTLLPAAFSMAMLGAIESLLCAVVL
DGMTGTKHKANSELVGQGLGNIIAPFFGGITATAAIARSAANVRAGATSPISAVIHSILV
ILALLVLAPLLSWLPLSAMAALLLMVAWNMSEAHKVVDLLRHAPKDDIIVMLLCMSLTVL
FDMVIAISVGIVLASLLFMRRIARMTRLAPVVVDVPDDVLVLRVIGPLFFAAAEGLFTDL
ESRLEGKRIVILKWDAVPVLDAGGLDAFQRFVKRLPEGCELRVCNVEFQPLRTMARAGIQ
PIPGRLAFFPNRRAAMADL
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory