Comparing 15356 FitnessBrowser__Keio:15356 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
6knlA Uridine and triphosphate-bound ugpase from acinetobacter baumannii
56% identity, 96% coverage: 8:296/302 of query aligns to 2:288/290 of 6knlA
6k8dA Udp-glucose pyrophosphorylase with upg from acinetobacter baumanii
56% identity, 96% coverage: 8:296/302 of query aligns to 2:288/290 of 6k8dA
6ikzB Udp-glucose pyrophosphorylase from acinetobacter baumanii
55% identity, 96% coverage: 8:296/302 of query aligns to 2:283/285 of 6ikzB
5i1fA Crystal structure of utp-glucose-1-phosphate uridylyltransferase from burkholderia vietnamiensis in complex with uridine-5'-diphosphate- glucose
53% identity, 97% coverage: 7:298/302 of query aligns to 4:289/290 of 5i1fA
5ve7A Crystal structure of utp-glucose-1-phosphate uridylyltransferase from burkholderia ambifaria in complex with utp
54% identity, 95% coverage: 7:294/302 of query aligns to 2:279/282 of 5ve7A
8f73E Crystal structure of pseudomonas aeruginosa udp-glucose phosphorylase in complex with udp-glucose
43% identity, 89% coverage: 8:275/302 of query aligns to 8:270/281 of 8f73E
2ux8G Crystal structure of sphingomonas elodea atcc 31461 glucose-1- phosphate uridylyltransferase in complex with glucose-1-phosphate. (see paper)
41% identity, 97% coverage: 8:299/302 of query aligns to 5:288/288 of 2ux8G
3jukD The crystal structure of udp-glucose pyrophosphorylase complexed with udp-glucose (see paper)
41% identity, 90% coverage: 8:279/302 of query aligns to 2:260/264 of 3jukD
3jukA The crystal structure of udp-glucose pyrophosphorylase complexed with udp-glucose (see paper)
41% identity, 90% coverage: 8:279/302 of query aligns to 2:260/265 of 3jukA
8b6dA Crystal structure of udp-glucose pyrophosphorylase from thermocrispum agreste dsm 44070 in complex with udp
40% identity, 95% coverage: 11:298/302 of query aligns to 5:288/291 of 8b6dA
2ux8A Crystal structure of sphingomonas elodea atcc 31461 glucose-1- phosphate uridylyltransferase in complex with glucose-1-phosphate. (see paper)
36% identity, 97% coverage: 8:299/302 of query aligns to 5:255/255 of 2ux8A
8b68A Crystal structure of udp-glucose pyrophosphorylase from thermocrispum agreste dsm 44070 in complex with udp-glucose
38% identity, 96% coverage: 11:299/302 of query aligns to 5:284/286 of 8b68A
2pa4B Crystal structure of udp-glucose pyrophosphorylase from corynebacteria glutamicum in complex with magnesium and udp-glucose (see paper)
39% identity, 96% coverage: 8:296/302 of query aligns to 3:288/299 of 2pa4B
6n0uA Crystal structure of a glucose-1-phosphate thymidylyltransferase from burkholderia phymatum bound to 2'-deoxy-thymidine-b-l-rhamnose
26% identity, 82% coverage: 9:255/302 of query aligns to 4:214/295 of 6n0uA
1h5tA Thymidylyltransferase complexed with thymidylyldiphosphate-glucose (see paper)
25% identity, 98% coverage: 7:301/302 of query aligns to 1:249/290 of 1h5tA
Sites not aligning to the query:
1h5rA Thymidylyltransferase complexed with thimidine and glucose-1-phospate (see paper)
25% identity, 98% coverage: 7:301/302 of query aligns to 1:249/290 of 1h5rA
Sites not aligning to the query:
5ifyA Crystal structure of glucose-1-phosphate thymidylyltransferase from burkholderia vietnamiensis in complex with 2 -deoxyuridine-5'- monophosphate and 2'-deoxy-thymidine-b-l-rhamnose
27% identity, 78% coverage: 9:243/302 of query aligns to 2:200/293 of 5ifyA
Sites not aligning to the query:
1h5sB Thymidylyltransferase complexed with tmp (see paper)
25% identity, 98% coverage: 7:301/302 of query aligns to 2:250/291 of 1h5sB
Sites not aligning to the query:
P26393 Glucose-1-phosphate thymidylyltransferase; dTDP-glucose pyrophosphorylase; Ep; dTDP-glucose synthase; EC 2.7.7.24 from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) (see paper)
26% identity, 98% coverage: 7:301/302 of query aligns to 2:250/292 of P26393
3pkpA Q83s variant of s. Enterica rmla with datp (see paper)
26% identity, 98% coverage: 7:301/302 of query aligns to 2:250/290 of 3pkpA
>15356 FitnessBrowser__Keio:15356
MAAINTKVKKAVIPVAGLGTRMLPATKAIPKEMLPLVDKPLIQYVVNECIAAGITEIVLV
THSSKNSIENHFDTSFELEAMLEKRVKRQLLDEVQSICPPHVTIMQVRQGLAKGLGHAVL
CAHPVVGDEPVAVILPDVILDEYESDLSQDNLAEMIRRFDETGHSQIMVEPVADVTAYGV
VDCKGVELAPGESVPMVGVVEKPKADVAPSNLAIVGRYVLSADIWPLLAKTPPGAGDEIQ
LTDAIDMLIEKETVEAYHMKGKSHDCGNKLGYMQAFVEYGIRHNTLGTEFKAWLEEEMGI
KK
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory