Comparing 15367 FitnessBrowser__Keio:15367 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
Q8RDH4 Dipeptide transport ATP-binding protein DppD; EC 7.4.2.9 from Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4) (Thermoanaerobacter tengcongensis) (see paper)
36% identity, 92% coverage: 10:316/334 of query aligns to 3:303/326 of Q8RDH4
Sites not aligning to the query:
4fwiB Crystal structure of the nucleotide-binding domain of a dipeptide abc transporter (see paper)
36% identity, 92% coverage: 10:316/334 of query aligns to 2:292/310 of 4fwiB
Sites not aligning to the query:
P0AAH4 Putrescine export system ATP-binding protein SapD from Escherichia coli (strain K12) (see paper)
34% identity, 95% coverage: 11:328/334 of query aligns to 3:321/330 of P0AAH4
7z15I E. Coli c-p lyase bound to a phnk/phnl dual abc dimer and adp + pi (see paper)
37% identity, 69% coverage: 38:268/334 of query aligns to 17:247/253 of 7z15I
Sites not aligning to the query:
7z18I E. Coli c-p lyase bound to a phnk abc dimer and atp (see paper)
37% identity, 69% coverage: 38:268/334 of query aligns to 17:247/250 of 7z18I
Sites not aligning to the query:
7z16I E. Coli c-p lyase bound to phnk/phnl dual abc dimer with amppnp and phnk e171q mutation (see paper)
36% identity, 69% coverage: 38:268/334 of query aligns to 17:247/250 of 7z16I
Sites not aligning to the query:
2d62A Crystal structure of multiple sugar binding transport atp- binding protein
35% identity, 72% coverage: 31:270/334 of query aligns to 13:248/375 of 2d62A
P30750 Methionine import ATP-binding protein MetN; EC 7.4.2.11 from Escherichia coli (strain K12) (see 3 papers)
36% identity, 72% coverage: 30:268/334 of query aligns to 11:244/343 of P30750
Sites not aligning to the query:
3tuzC Inward facing conformations of the metni methionine abc transporter: cy5 semet soak crystal form (see paper)
36% identity, 72% coverage: 30:268/334 of query aligns to 12:245/344 of 3tuzC
Sites not aligning to the query:
3tuiC Inward facing conformations of the metni methionine abc transporter: cy5 native crystal form (see paper)
36% identity, 72% coverage: 30:268/334 of query aligns to 12:245/344 of 3tuiC
6cvlD Crystal structure of the escherichia coli atpgs-bound metni methionine abc transporter in complex with its metq binding protein (see paper)
36% identity, 72% coverage: 30:268/334 of query aligns to 12:245/344 of 6cvlD
1g291 Malk (see paper)
34% identity, 72% coverage: 31:270/334 of query aligns to 10:245/372 of 1g291
Sites not aligning to the query:
3c4jA Abc protein artp in complex with atp-gamma-s
34% identity, 70% coverage: 36:268/334 of query aligns to 15:241/242 of 3c4jA
Sites not aligning to the query:
3c41J Abc protein artp in complex with amp-pnp/mg2+
34% identity, 70% coverage: 36:268/334 of query aligns to 15:241/242 of 3c41J
Sites not aligning to the query:
2olkA Abc protein artp in complex with adp-beta-s
34% identity, 70% coverage: 36:268/334 of query aligns to 15:241/242 of 2olkA
Sites not aligning to the query:
2oljA Abc protein artp in complex with adp/mg2+
34% identity, 70% coverage: 36:268/334 of query aligns to 15:241/242 of 2oljA
Sites not aligning to the query:
4ymuJ Crystal structure of an amino acid abc transporter complex with arginines and atps (see paper)
35% identity, 71% coverage: 31:268/334 of query aligns to 8:239/240 of 4ymuJ
1oxvD Crystal structure of glcv, the abc-atpase of the glucose abc transporter from sulfolobus solfataricus (see paper)
36% identity, 69% coverage: 39:268/334 of query aligns to 20:244/353 of 1oxvD
Sites not aligning to the query:
1oxvA Crystal structure of glcv, the abc-atpase of the glucose abc transporter from sulfolobus solfataricus (see paper)
36% identity, 69% coverage: 39:268/334 of query aligns to 20:244/353 of 1oxvA
Sites not aligning to the query:
1oxuA Crystal structure of glcv, the abc-atpase of the glucose abc transporter from sulfolobus solfataricus (see paper)
36% identity, 69% coverage: 39:268/334 of query aligns to 20:244/353 of 1oxuA
Sites not aligning to the query:
>15367 FitnessBrowser__Keio:15367
MNAVTEGRKVLLEIADLKVHFEIKDGKQWFWQPPKTLKAVDGVTLRLYEGETLGVVGESG
CGKSTFARAIIGLVKATDGHVAWLGKELLGMKPDEWRAVRSDIQMIFQDPLASLNPRMTI
GEIIAEPLRTYHPKMSRQEVRERVKAMMLKVGLLPNLINRYPHEFSGGQCQRIGIARALI
LEPKLIICDEPVSALDVSIQAQVVNLLQQLQREMGLSLIFIAHDLAVVKHISDRVLVMYL
GHAVELGTYDEVYHNPLHPYTRALMSAVPIPDPDLEKNKTIQLLEGELPSPINPPSGCVF
RTRCPIAGPECAKTRPVLEGSFRHSVSCLKVDPL
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory